DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and Ctdspl

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_598471.3 Gene:Ctdspl / 69274 MGIID:1916524 Length:276 Species:Mus musculus


Alignment Length:193 Identity:61/193 - (31%)
Similarity:92/193 - (47%) Gaps:28/193 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 RKKLLPDPLQPP--YVQPPYT--------LVLEIKDVLVHPDWTYETGWRF-------------- 233
            :::::|.| .||  |:.|..|        :|:::.:.|||..:...:...|              
Mouse    81 QRQVIPVP-SPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVY 144

  Fly   234 -KKRPGVDVFLKECAKYFEIVVYTAEQGVTVFPLVDALDPNGCIMYRLVRDSTHFDGGHHVKNLD 297
             .|||.||.||:...:.||.|::||.......|:.|.||..|....||.|:|..|..|::||:|.
Mouse   145 VLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLS 209

  Fly   298 NLNRDLKRVVVVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREVL 360
            .|.|:|.:|::||....|..|||.|:..:..|..:..||.|.:|..|..  |.|..|||..:|
Mouse   210 RLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFE--GLSREDDVYSML 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 45/150 (30%)
CtdsplNP_598471.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
FCP1 <95..270 CDD:227517 55/176 (31%)
HIF-SF_euk 106..265 CDD:274055 50/160 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.