DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and ctdspl3

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_021335375.1 Gene:ctdspl3 / 571337 ZFINID:ZDB-GENE-141215-56 Length:360 Species:Danio rerio


Alignment Length:233 Identity:70/233 - (30%)
Similarity:103/233 - (44%) Gaps:46/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 SLDEHGNEVIDEFSCLPQMQQLMWRTWKSVNRFQRFFKEPSRKKLLPDPLQ-----PPYVQ--PP 209
            |.||...||...|:.:..:.          ||.|:     ||      |:.     ||..:  |.
Zfish   138 SEDEENEEVFSPFTFIKNIP----------NRSQQ-----SR------PVSAVRDIPPKTRSTPA 181

  Fly   210 YTLVLEIKDVLVH------PDWTYETGWRFKK---------RPGVDVFLKECAKYFEIVVYTAEQ 259
            .||||::.:.||.      ||..|....||:.         ||.|..||:...|:||:.|||:.:
Zfish   182 ATLVLDLDETLVFSSLNVIPDAEYTFNTRFQDHKYKVYVILRPHVREFLQAMTKHFEMFVYTSAK 246

  Fly   260 GVTVFPLVDALDPNGCIM-YRLVRDSTHFDGGHHVKNLDNLNRDLKRVVVVDWDRNSTKFHPSNS 323
            ......:||.||||..:. :||.:|......||::|:|..|.|||.:.|::|...::..:|..|.
Zfish   247 KEYAEKIVDILDPNKKLFRHRLYQDDCACVLGHYIKDLTILERDLSKTVILDNAPHTFPYHLMNM 311

  Fly   324 FSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREVLQ 361
            ..|..|.|:..|..|.:|..::..|  ...||.|.||:
Zfish   312 IPIKSWIGDQEDRELQKLIPYMEKL--VHADDFRNVLK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 47/143 (33%)
ctdspl3XP_021335375.1 Atrophin-1 <19..182 CDD:331285 15/64 (23%)
NIF 183..343 CDD:308590 52/161 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.