DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and ctdspl2a

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001071012.1 Gene:ctdspl2a / 558181 ZFINID:ZDB-GENE-061013-647 Length:469 Species:Danio rerio


Alignment Length:198 Identity:56/198 - (28%)
Similarity:94/198 - (47%) Gaps:26/198 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 SRKKLLPDPLQPPYVQPPYTLVLEIKDVLVH-----------------PDWTYETGWRFKKRPGV 239
            :||..||...:.   .|.::|||::.:.|||                 .|..|:...|.  ||..
Zfish   276 TRKPALPLKTRS---TPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRL--RPFF 335

  Fly   240 DVFLKECAKYFEIVVYTAEQGVTVFPLVDALDP-NGCIMYRLVRDSTHFDGGHHVKNLDNLNRDL 303
            ..||:..::.:||:::||.:.|....|::.||| ...:.:||.|:......|:::|:|:.|.|||
Zfish   336 REFLERMSQIYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDL 400

  Fly   304 KRVVVVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELTSFLSVLGTSEI-DDVREVLQYYNQFS 367
            .:.|::|....:..:..||...|..|..:.||..|.:|..||..|  .|: :|||..::...:..
Zfish   401 SKTVIIDNSPQAFAYQLSNGIPIESWFVDKNDNELLKLVPFLEKL--VELNEDVRPYIRERFRLH 463

  Fly   368 DSL 370
            |.|
Zfish   464 DLL 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 40/145 (28%)
ctdspl2aNP_001071012.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..136
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..209
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 231..250
HIF-SF_euk 290..445 CDD:274055 44/156 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.