Sequence 1: | NP_612023.1 | Gene: | ttm2 / 38049 | FlyBaseID: | FBgn0035124 | Length: | 409 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001071012.1 | Gene: | ctdspl2a / 558181 | ZFINID: | ZDB-GENE-061013-647 | Length: | 469 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 56/198 - (28%) |
---|---|---|---|
Similarity: | 94/198 - (47%) | Gaps: | 26/198 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 192 SRKKLLPDPLQPPYVQPPYTLVLEIKDVLVH-----------------PDWTYETGWRFKKRPGV 239
Fly 240 DVFLKECAKYFEIVVYTAEQGVTVFPLVDALDP-NGCIMYRLVRDSTHFDGGHHVKNLDNLNRDL 303
Fly 304 KRVVVVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELTSFLSVLGTSEI-DDVREVLQYYNQFS 367
Fly 368 DSL 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ttm2 | NP_612023.1 | CPDc | 208..336 | CDD:214729 | 40/145 (28%) |
ctdspl2a | NP_001071012.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..42 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 73..136 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 181..209 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 231..250 | ||||
HIF-SF_euk | 290..445 | CDD:274055 | 44/156 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5190 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |