DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and ctdsp1

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_021334687.1 Gene:ctdsp1 / 553744 ZFINID:ZDB-GENE-050522-523 Length:1222 Species:Danio rerio


Alignment Length:301 Identity:82/301 - (27%)
Similarity:122/301 - (40%) Gaps:71/301 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TSEESND-------EESRERRKLE---------EEEEQKELERAFRRMKLGFGLFGIGSMLFSFW 143
            |||..|.       |:::...|||         |..||:.:.::.::.        .|....|  
Zfish   953 TSELLNSPAVGGLAEQTKPNEKLEELIHQVARSEASEQEAICKSDQKK--------TGEQCDS-- 1007

  Fly   144 AIYFYGRPSLDEHGNEVIDEFSCLPQMQQLMWRTWKSVNRFQRFFKEPSRKKLLPDPLQPPYVQP 208
              |.....|.||..:|..|...|:|...|:                 |::      ||.|.....
Zfish  1008 --YEDSESSEDEEFSEDCDCEICVPPTDQV-----------------PAK------PLLPQIKSK 1047

  Fly   209 ---PYTLVLEIKDVLVHPDWTYETGWRF---------------KKRPGVDVFLKECAKYFEIVVY 255
               ...:|:::.:.|||..:.......|               .|||.||.|||...:.||.|::
Zfish  1048 DVGKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGTVHQVYVLKRPHVDEFLKRMGELFECVLF 1112

  Fly   256 TAEQGVTVFPLVDALDPNGCIMYRLVRDSTHFDGGHHVKNLDNLNRDLKRVVVVDWDRNSTKFHP 320
            ||.......|:.|.||..|....||.|:|..|..|::||:|..|.|||.:|::||....|..|||
Zfish  1113 TASLAKYADPVSDLLDKWGAFRSRLFRESCVFHRGNYVKDLSRLGRDLNKVIIVDNSPASYIFHP 1177

  Fly   321 SNSFSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREVLQ 361
            .|:..:..|..:.:||.|.:|..|...|  |::|:|..||:
Zfish  1178 DNAVPVASWFDDMSDTELLDLIPFFERL--SKVDNVYTVLK 1216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 45/145 (31%)
ctdsp1XP_021334687.1 HIF-SF_euk 1051..1209 CDD:274055 52/159 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.