DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and hzg

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001261912.1 Gene:hzg / 39748 FlyBaseID:FBgn0036556 Length:352 Species:Drosophila melanogaster


Alignment Length:246 Identity:66/246 - (26%)
Similarity:107/246 - (43%) Gaps:50/246 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 PDPL--QPPYVQPPYTL--------VLEIKDVLVHPDWTYETGWRFK------------------ 234
            |.||  |..|:.|...|        |:::.:.|||..        ||                  
  Fly    91 PPPLPDQQRYLLPQVRLTDMHRKCMVIDLDETLVHSS--------FKPIPNADFIVPVEIDGTVH 147

  Fly   235 -----KRPGVDVFLKECAKYFEIVVYTAEQGVTVFPLVDALDPNGCIMYRLVRDSTHFDGGHHVK 294
                 |||.||.||::..:.:|.|::||.......|:.|.||.......||.|:|..:..|:::|
  Fly   148 QVYVLKRPHVDEFLQKMGELYECVLFTASLAKYADPVADLLDKWNVFRARLFRESCVYYRGNYIK 212

  Fly   295 NLDNLNRDLKRVVVVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREV 359
            :|:.|.|||:::|:||....|..|||.|:..:..|..:..|..|.||......|  |::|.|..|
  Fly   213 DLNRLGRDLQKIVIVDNSPASYIFHPDNAVPVKSWFDDVTDCELRELIPLFEKL--SKVDSVYSV 275

  Fly   360 LQYYNQ-FSDSLSQFRENQ------RKLGELMHAEEVEKTSKSRPVVKNWT 403
            |...|| .::..:|.:..|      .:|.:.:..::.::|..:..|:...|
  Fly   276 LCNSNQPLNNQTNQQQHPQELQQAPNQLHQQLQQQQQQQTISATTVITQAT 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 43/158 (27%)
hzgNP_001261912.1 HIF-SF_euk 112..270 CDD:274055 47/167 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461635
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.