DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and CG12078

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_647795.2 Gene:CG12078 / 38401 FlyBaseID:FBgn0035426 Length:253 Species:Drosophila melanogaster


Alignment Length:261 Identity:60/261 - (22%)
Similarity:103/261 - (39%) Gaps:44/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 FWAIYFYGRPSLDEHGNEVIDEFSCLPQMQQLMWRTWKSVNRFQRFFKEPSRKKLLPDPLQPPYV 206
            |..||.:|..::.     ::...:|:     ::.|.|..:.:..|.|.|.:....|.:....|..
  Fly     7 FLIIYVFGLATMG-----LMMGIACV-----VIPRLWFFLEKVYRVFVEYTPIIYLSEDRLSPVS 61

  Fly   207 QPPYTLVLEIKDVLVHPDWTYETGWRFK-----------------------------KRPGVDVF 242
            :...:||.. |.:::..|.|..|.|..|                             |||.:|.|
  Fly    62 KSRLSLVAR-KTLVLDMDNTMITSWFIKRGKKPKNIPRIAHDFKFYLPAYGATIYVYKRPYLDHF 125

  Fly   243 LKECAKYFEIVVYTAEQGVTVFPLVDALD-PNGCIMYRLVRDSTHFDGGHHVKNLDNLNRDLKRV 306
            |...:|::::.|:|:...:...|::|.|| ..|.:..||.|.......|...|::.....||..|
  Fly   126 LDRVSKWYDLTVFTSGAEIYASPILDFLDRGRGILNSRLYRQHCIEQFGKWSKSVLLACPDLSNV 190

  Fly   307 VVVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREVLQYYNQFSDSLS 371
            |::|.......|:..|:..|..:.....|..|..|..||..|  ..:.|||.:|:...:| :|.:
  Fly   191 VLLDNSSTECSFNAENAILIKSYEIGCRDEALINLLPFLDAL--RFMKDVRSMLKRCTRF-ESFA 252

  Fly   372 Q 372
            |
  Fly   253 Q 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 35/157 (22%)
CG12078NP_647795.2 HIF-SF_euk 70..237 CDD:274055 39/169 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461636
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.