DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and Ctdsp1

DIOPT Version :10

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_063123456.1 Gene:Ctdsp1 / 363249 RGDID:1305629 Length:265 Species:Rattus norvegicus


Alignment Length:129 Identity:44/129 - (34%)
Similarity:64/129 - (49%) Gaps:15/129 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 LVLEIKDVLVHPDWTYETGWRF---------------KKRPGVDVFLKECAKYFEIVVYTAEQGV 261
            :|:::.:.|||..:.......|               .|||.||.||:...:.||.|::||....
  Rat    93 VVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAK 157

  Fly   262 TVFPLVDALDPNGCIMYRLVRDSTHFDGGHHVKNLDNLNRDLKRVVVVDWDRNSTKFHPSNSFS 325
            ...|:.|.||..|....||.|:|..|..|::||:|..|.|||:||:::|....|..|||.|:.|
  Rat   158 YADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 44/129 (34%)
PRK00771 <349..384 CDD:179118
Ctdsp1XP_063123456.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.