DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and CG8584

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_610404.1 Gene:CG8584 / 35856 FlyBaseID:FBgn0033322 Length:293 Species:Drosophila melanogaster


Alignment Length:192 Identity:52/192 - (27%)
Similarity:82/192 - (42%) Gaps:39/192 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 TLVLEIKDVLVH----------------------PDWTYETG--------WRFKKRPGVDVFLKE 245
            ||||::.:.|||                      ||:.....        :|..|||.||.||..
  Fly    97 TLVLDLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVFKRPHVDEFLDF 161

  Fly   246 CAKYFEIVVYTAEQGVTVFPLVDALDP-NGCIMYRLVRDSTHFDGGHHVKNLDNLNRDLKRVVVV 309
            .:|::::|:|||...|....:||.||. .|.|..|..|...........|:|..:..|:..|:::
  Fly   162 VSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQHCRASSPMVSKDLTLVTPDMSGVLII 226

  Fly   310 DWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREVL------QYYNQ 365
            |....:.:..|.|:..|..:..:.:||.|.::..||..|..::  |||.:|      .|||:
  Fly   227 DNSPYAYRDFPDNAIPIKTFIYDPDDTELLKMLPFLDALRFTK--DVRSILGRRVIRHYYNR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 39/155 (25%)
CG8584NP_610404.1 HIF-SF_euk 95..270 CDD:274055 45/174 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461638
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12210
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.