DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and Ctdspl2

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_997615.1 Gene:Ctdspl2 / 329506 MGIID:1196405 Length:465 Species:Mus musculus


Alignment Length:218 Identity:59/218 - (27%)
Similarity:99/218 - (45%) Gaps:39/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 EVIDEFSCLPQMQQLMWRTWKSVNRFQRFFKEPSRKKLLPDPLQPPYVQPPYTLVLEIKDVLVH- 222
            ||.|.:..:..:..|   |.:.:|          ||..||...:.   .|.::|||::.:.||| 
Mouse   252 EVFDPYYFIKHVPPL---TEEQLN----------RKPALPLKTRS---TPEFSLVLDLDETLVHC 300

  Fly   223 ----------------PDWTYETGWRFKKRPGVDVFLKECAKYFEIVVYTAEQGVTVFPLVDALD 271
                            .|..|:...|.  ||....||:..::.:||:::||.:.|....|::.||
Mouse   301 SLNELEDAALTFPVLFQDVIYQVYVRL--RPFFREFLERMSQMYEIILFTASKKVYADKLLNILD 363

  Fly   272 P-NGCIMYRLVRDSTHFDGGHHVKNLDNLNRDLKRVVVVDWDRNSTKFHPSNSFSIPRWSGNDND 335
            | ...:.:||.|:......|:::|:|:.|.|||.:.:::|....:..:..||...|..|..:.||
Mouse   364 PKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKND 428

  Fly   336 TTLFELTSFLSVLGTSEI-DDVR 357
            ..|.:|..||..|  .|: :|||
Mouse   429 NELLKLIPFLEKL--VELNEDVR 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 39/145 (27%)
Ctdspl2NP_997615.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..239
HIF-SF_euk 286..447 CDD:274055 45/164 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.