DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and Ctdspl

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_001382669.1 Gene:Ctdspl / 301056 RGDID:1304841 Length:276 Species:Rattus norvegicus


Alignment Length:253 Identity:67/253 - (26%)
Similarity:103/253 - (40%) Gaps:66/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 EHGNEVIDEFSCLPQMQQLMWRTWKSVNRFQRFFKEP----------------------SRKKLL 197
            :.|..::..|.|.                |:.:..||                      .:::::
  Rat    37 QRGRSILSSFFCC----------------FRDYNVEPPPPSSPSVLPPLVEENGGLQKGDQRQVI 85

  Fly   198 PDPLQPP--YVQPPYT--------LVLEIKDVLVHPDWTYETGWRF---------------KKRP 237
            |.| .||  |:.|..|        :|:::.:.|||..:...:...|               .|||
  Rat    86 PVP-SPPAKYLLPEVTVLDHGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRP 149

  Fly   238 GVDVFLKECAKYFEIVVYTAEQGVTVFPLVDALDPNGCIMYRLVRDSTHFDGGHHVKNLDNLNRD 302
            .||.||:...:.||.|::||.......|:.|.||..|....||.|:|..|..|::||:|..|.|:
  Rat   150 HVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRE 214

  Fly   303 LKRVVVVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREVL 360
            |.:|::||....|..|||.|:..:..|..:..||.|.:|..|..  |.|..|||..:|
  Rat   215 LSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFE--GLSREDDVYRML 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 45/150 (30%)
CtdsplNP_001382669.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.