DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and Ctdnep1

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_017452582.2 Gene:Ctdnep1 / 287447 RGDID:1310172 Length:285 Species:Rattus norvegicus


Alignment Length:192 Identity:51/192 - (26%)
Similarity:87/192 - (45%) Gaps:34/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 LVLEIKDVLVH----------------PDWTYET-----GWRF--KKRPGVDVFLKECAKYFEIV 253
            |||::.:.|:|                ||:..:.     ..||  .|||.||.||:..::::|:|
  Rat    96 LVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELV 160

  Fly   254 VYTAEQGVTVFPLVDALDPNGCIM-YRLVRDSTHFDGGHHVKNLDNLNRDLKRVVVVDWDRNSTK 317
            |:||...:....:.|.||.:..|: .|..|.....:.|.::|:|..::.||..:|::|....:.:
  Rat   161 VFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYR 225

  Fly   318 FHP----SNSFSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREVLQYYNQFSDSLSQFRE 375
            .||    .|:..|..|..:.:||.|..|...|..| ::.|..|     :|..:.|...|.:|
  Rat   226 SHPGMGKDNAIPIKSWFSDPSDTALLNLLPMLDAL-SAVITGV-----HYQNWQDLDCQGKE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 39/151 (26%)
Ctdnep1XP_017452582.2 HIF-SF_euk 93..263 CDD:274055 45/167 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.