DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and Ctdsp1

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_036020359.1 Gene:Ctdsp1 / 227292 MGIID:2654470 Length:302 Species:Mus musculus


Alignment Length:227 Identity:69/227 - (30%)
Similarity:97/227 - (42%) Gaps:50/227 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 IGSMLFSFWAIYFYGRPSLDEHGNEVIDEFSCLPQMQQLMWRTWKSVNRFQRFFKEPSRKKLLPD 199
            |..::...|.:  .|..|||...:..:.    :|    |:|.|.|.|.:                
Mouse   120 IDGVVHQEWGM--VGAASLDCPSSSTVP----VP----LLWITPKPVGQ---------------- 158

  Fly   200 PLQPPYVQPPYTLVLEIKDVLVHPDWTYETGWRFKKRPGVDVFLKECAKYFEIVVYTAEQGVTVF 264
              |.|:...|...||                    |||.||.||:...:.||.|::||.......
Mouse   159 --QLPHWLVPQVYVL--------------------KRPHVDEFLQRMGELFECVLFTASLAKYAD 201

  Fly   265 PLVDALDPNGCIMYRLVRDSTHFDGGHHVKNLDNLNRDLKRVVVVDWDRNSTKFHPSNSFSIPRW 329
            |:.|.||..|....||.|:|..|..|::||:|..|.|||:||:::|....|..|||.|:..:..|
Mouse   202 PVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASW 266

  Fly   330 SGNDNDTTLFELTSFLSVLGTSEIDDVREVLQ 361
            ..|.:||.|.:|..|...|  |.:|||..||:
Mouse   267 FDNMSDTELHDLLPFFEQL--SRVDDVYSVLR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 43/127 (34%)
Ctdsp1XP_036020359.1 HIF-SF_euk 90..290 CDD:274055 64/219 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.