DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and scpl-1

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_740912.2 Gene:scpl-1 / 181944 WormBaseID:WBGene00007054 Length:491 Species:Caenorhabditis elegans


Alignment Length:209 Identity:59/209 - (28%)
Similarity:94/209 - (44%) Gaps:32/209 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 SRKKLLPDPLQPPYVQPPYTLVLEIKDVLVH--------PDWT-------YETGWRFKKRPGVDV 241
            :.|.||| ||.|...... .||:::.:.|||        ||:.       .|......|||.||.
 Worm   296 NEKPLLP-PLLPQDSNKK-CLVIDLDETLVHSSFKPVKNPDFVIPVEIDGVEHQVYVLKRPYVDE 358

  Fly   242 FLKECAKYFEIVVYTAEQGVTVFPLVDALDPNGCIMYRLVRDSTHFDGGHHVKNLDNLNRDLKRV 306
            ||.:..::||.:::||.......|:.|.||.......||.|::..|..|::||:|..|.|:|.:.
 Worm   359 FLAKVGEHFECILFTASLAKYADPVADLLDKKRVFRGRLFREACVFHKGNYVKDLSRLGRNLNQT 423

  Fly   307 VVVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREVLQYYNQFSDSLS 371
            :::|....|..|||.|:..:..|..:.:||               |:.|:...|::.|.||....
 Worm   424 LIIDNSPASYAFHPENAVPVTTWFDDPSDT---------------ELLDILPSLEHLNGFSSIYD 473

  Fly   372 QFRENQRKLGELMH 385
            .:|..:....||::
 Worm   474 LYRPEEGPQSELLN 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 41/142 (29%)
scpl-1NP_740912.2 HIF-SF_euk 311..465 CDD:274055 46/169 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.