DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and fcp-1

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_492423.2 Gene:fcp-1 / 172719 WormBaseID:WBGene00009479 Length:659 Species:Caenorhabditis elegans


Alignment Length:233 Identity:52/233 - (22%)
Similarity:81/233 - (34%) Gaps:87/233 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 HPDWT--------YETGWRFKKRPGVDVFLKECAKYFEIVVYTAEQGVTVFPLVDALDPNGCIMY 278
            |.|.|        |.|    |.||....||.:.:..:|:.:.|..|......:...|||:..:..
 Worm   169 HKDITKYNLHSRVYTT----KLRPHTTEFLNKMSNMYEMHIVTYGQRQYAHRIAQILDPDARLFE 229

  Fly   279 R--LVRDSTHFDGGHHVKNL-------DNLNRDLKRVVVVDWDRNSTKFH--------------- 319
            :  |.||.. |...|...||       |||      ||::| ||:....:               
 Worm   230 QRILSRDEL-FSAQHKTNNLKALFPCGDNL------VVIID-DRSDVWMYSEALIQIKPYRFFKE 286

  Fly   320 ------PSNS-FSIPRWSGND--NDTTLFELTSFLS-----------VLGTSEI-DDVREVLQYY 363
                  |.|| ..:|....:|  .|..|.|:...|:           :.|:.|: .||:||:   
 Worm   287 VGDINAPKNSKEQMPVQIEDDAHEDKVLEEIERVLTNIHDKYYEKHDLRGSEEVLLDVKEVI--- 348

  Fly   364 NQFSDSLSQFRENQRKL---------GELMHAEEVEKT 392
                      :|.:.|:         |.:...|::|:|
 Worm   349 ----------KEERHKVLDGCVIVFSGIVPMGEKLERT 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 36/154 (23%)
fcp-1NP_492423.2 HAD_like 138..284 CDD:328728 31/126 (25%)
BRCT 358..431 CDD:237994 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.