DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and UBLCP1

DIOPT Version :10

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_659486.2 Gene:UBLCP1 / 134510 HGNCID:28110 Length:318 Species:Homo sapiens


Alignment Length:235 Identity:49/235 - (20%)
Similarity:89/235 - (37%) Gaps:49/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 NEVIDEFSCLPQMQQLMWRTWKSVNRFQRFFKEPSR-KKLLPDPLQPPYVQPPYTLVLEIKDVLV 221
            ::|:::|....::.::       .||.:...|...| |:...:.|.||. :....|||::...|.
Human    93 DDVVNDFDIEDEVVEV-------ENREENLLKISRRVKEYKVEILNPPR-EGKKLLVLDVDYTLF 149

  Fly   222 HPDWTYETGWRFKKRPGVDVFLKECAKYFEIVVYTA-----------EQGVTV---FPLVDALDP 272
            ......|||... .||.:..||....:.::||:::|           |.||:.   :.:...||.
Human   150 DHRSCAETGVEL-MRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDS 213

  Fly   273 NGCIMYRLVRDST-----------HFDGGHHVKN---LDNLNRDLKRVVVVDWDRNSTKFHPSNS 323
            ...|.....|...           .|...:..||   .|::.|:.     :...:|..|..|...
Human   214 AAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNF-----LMNPQNGLKIRPFMK 273

  Fly   324 FSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREVLQYY 363
            ..:.|    |.|..|.:||.:|..:  :::||..::...|
Human   274 AHLNR----DKDKELLKLTQYLKEI--AKLDDFLDLNHKY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 31/155 (20%)
PRK00771 <349..384 CDD:179118 3/15 (20%)
UBLCP1NP_659486.2 Ubl_UBLCP1 3..77 CDD:340511
HAD_IIID1 117..311 CDD:131299 45/204 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.