DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ttm2 and UBLCP1

DIOPT Version :9

Sequence 1:NP_612023.1 Gene:ttm2 / 38049 FlyBaseID:FBgn0035124 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_659486.2 Gene:UBLCP1 / 134510 HGNCID:28110 Length:318 Species:Homo sapiens


Alignment Length:235 Identity:49/235 - (20%)
Similarity:89/235 - (37%) Gaps:49/235 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 NEVIDEFSCLPQMQQLMWRTWKSVNRFQRFFKEPSR-KKLLPDPLQPPYVQPPYTLVLEIKDVLV 221
            ::|:::|....::.::       .||.:...|...| |:...:.|.||. :....|||::...|.
Human    93 DDVVNDFDIEDEVVEV-------ENREENLLKISRRVKEYKVEILNPPR-EGKKLLVLDVDYTLF 149

  Fly   222 HPDWTYETGWRFKKRPGVDVFLKECAKYFEIVVYTA-----------EQGVTV---FPLVDALDP 272
            ......|||... .||.:..||....:.::||:::|           |.||:.   :.:...||.
Human   150 DHRSCAETGVEL-MRPYLHEFLTSAYEDYDIVIWSATNMKWIEAKMKELGVSTNANYKITFMLDS 213

  Fly   273 NGCIMYRLVRDST-----------HFDGGHHVKN---LDNLNRDLKRVVVVDWDRNSTKFHPSNS 323
            ...|.....|...           .|...:..||   .|::.|:.     :...:|..|..|...
Human   214 AAMITVHTPRRGLIDVKPLGVIWGKFSEFYSKKNTIMFDDIGRNF-----LMNPQNGLKIRPFMK 273

  Fly   324 FSIPRWSGNDNDTTLFELTSFLSVLGTSEIDDVREVLQYY 363
            ..:.|    |.|..|.:||.:|..:  :::||..::...|
Human   274 AHLNR----DKDKELLKLTQYLKEI--AKLDDFLDLNHKY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ttm2NP_612023.1 CPDc 208..336 CDD:214729 31/155 (20%)
UBLCP1NP_659486.2 Ubl_UBLCP1 3..77 CDD:340511
HAD_IIID1 117..311 CDD:131299 45/204 (22%)
Phosphatase 133..294 37/171 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.