DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment miple1 and mdka

DIOPT Version :9

Sequence 1:NP_001261197.1 Gene:miple1 / 38047 FlyBaseID:FBgn0027111 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_571145.1 Gene:mdka / 30277 ZFINID:ZDB-GENE-990621-1 Length:146 Species:Danio rerio


Alignment Length:62 Identity:24/62 - (38%)
Similarity:33/62 - (53%) Gaps:6/62 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 KSDGLSCRYGKNPWTECDTKTNTRSRTLTLKKG--DPACDQTRTIQKKC----KKACRYEKG 125
            |..|..|:|....|.|||..|:|:|||.||:|.  :..|.||.::.|.|    |...:.:||
Zfish    80 KEFGADCKYKFGNWGECDAATSTKSRTGTLQKALFNVECQQTVSVTKPCTTKVKNKPKGKKG 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
miple1NP_001261197.1 PTN_MK_C 73..124 CDD:395867 21/56 (38%)
PTN_MK_C 119..176 CDD:395867 2/7 (29%)
mdkaNP_571145.1 PTN_MK_N 39..118 CDD:295331 16/37 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1489280at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.