DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL17 and MRPL8

DIOPT Version :9

Sequence 1:NP_001261196.1 Gene:mRpL17 / 38046 FlyBaseID:FBgn0035122 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_012472.1 Gene:MRPL8 / 853382 SGDID:S000003599 Length:238 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:39/147 - (26%)
Similarity:67/147 - (45%) Gaps:26/147 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LRKTVTALVKHERIELFYNRADEARGYAELLI---------SNAIRHGD---RHQATMELADYWL 89
            |:.....|.:||.|...:.:..||...||.:|         ||::...:   :.|:.:.||..  
Yeast    20 LKNLACQLFQHESIVSTHAKCKEASRVAERIITWTKRAITTSNSVAQAELKSQIQSQLFLAGD-- 82

  Fly    90 LEKQLVHKLFKVLVPRYETYNVSYTRMYK-APREYPGIYYRRSVLELRGNPYPSLAADHSQNRN- 152
             .::|:.:||..:.|||......|||:.: .||.....  .:|||||..:|.  ::..|:.||. 
Yeast    83 -NRKLMKRLFSEIAPRYLERPGGYTRVLRLEPRANDSA--PQSVLELVDSPV--MSESHTVNRGN 142

  Fly   153 -----LLHNVLLDEARK 164
                 |:.:|:.|:|.:
Yeast   143 LKMWLLVKSVINDDANQ 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL17NP_001261196.1 Ribosomal_L17 37..121 CDD:279529 24/96 (25%)
MRPL8NP_012472.1 L17 7..127 CDD:272880 30/111 (27%)
Mrpl_C 129..238 CDD:408295 8/33 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0203
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003177
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100929
Panther 1 1.100 - - LDO PTHR14413
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1152
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.890

Return to query results.
Submit another query.