DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL17 and MRPL17

DIOPT Version :9

Sequence 1:NP_001261196.1 Gene:mRpL17 / 38046 FlyBaseID:FBgn0035122 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_071344.1 Gene:MRPL17 / 63875 HGNCID:14053 Length:175 Species:Homo sapiens


Alignment Length:149 Identity:61/149 - (40%)
Similarity:81/149 - (54%) Gaps:16/149 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GPEGRLLKLRKTVTALVKHERIELFYNRADEARGYAELLISNAIRHGDRHQATMELADYWLLEKQ 93
            |||.|:..||..:|.||:|||||..:.|.||.|||||.||... :.||.::..|.:||:||.||.
Human    21 GPESRIHLLRNLLTGLVRHERIEAPWARVDEMRGYAEKLIDYG-KLGDTNERAMRMADFWLTEKD 84

  Fly    94 LVHKLFKVLVPRYETYNVSYTRMYKAPREYPGIYYRRS-------VLELRGNPYPSLAADHSQNR 151
            |:.|||:||.|||:.....||||.:.|        .||       |:|.:||..|.|......:.
Human    85 LIPKLFQVLAPRYKDQTGGYTRMLQIP--------NRSLDRAKMAVIEYKGNCLPPLPLPRRDSH 141

  Fly   152 NLLHNVLLDEARKEFRRQK 170
            ..|.|.||...|::.|:.:
Human   142 LTLLNQLLQGLRQDLRQSQ 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL17NP_001261196.1 Ribosomal_L17 37..121 CDD:279529 42/83 (51%)
MRPL17NP_071344.1 Ribosomal_L17 28..125 CDD:395953 46/105 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..175 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 85 1.000 Domainoid score I8187
eggNOG 1 0.900 - - E1_COG0203
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32526
Inparanoid 1 1.050 103 1.000 Inparanoid score I4973
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55569
OrthoDB 1 1.010 - - D1540433at2759
OrthoFinder 1 1.000 - - FOG0003177
OrthoInspector 1 1.000 - - oto88420
orthoMCL 1 0.900 - - OOG6_100929
Panther 1 1.100 - - LDO PTHR14413
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1152
SonicParanoid 1 1.000 - - X5446
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.870

Return to query results.
Submit another query.