DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL17 and Mrpl17

DIOPT Version :9

Sequence 1:NP_001261196.1 Gene:mRpL17 / 38046 FlyBaseID:FBgn0035122 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_079577.1 Gene:Mrpl17 / 27397 MGIID:1351608 Length:176 Species:Mus musculus


Alignment Length:132 Identity:61/132 - (46%)
Similarity:81/132 - (61%) Gaps:2/132 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GPEGRLLKLRKTVTALVKHERIELFYNRADEARGYAELLISNAIRHGDRHQATMELADYWLLEKQ 93
            |||.|:..||..:|.||:|||||..:.||||.|||||.||... :.||.::..|.:||:||.||.
Mouse    21 GPESRIHLLRNLLTGLVRHERIEATWARADEMRGYAEKLIDYG-KLGDTNERAMRMADFWLTEKD 84

  Fly    94 LVHKLFKVLVPRYETYNVSYTRMYKAPREYPGIYYRRSVLELRGNPYPSLAADH-SQNRNLLHNV 157
            |:.||||||.||::..|.:||||.:.|........:.:|:|.:||..|.|...| ..|..||:.:
Mouse    85 LIPKLFKVLAPRFQGQNGNYTRMLQIPNRKEQDRAKMAVIEYKGNYLPPLPLPHRDSNLTLLNQL 149

  Fly   158 LL 159
            ||
Mouse   150 LL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL17NP_001261196.1 Ribosomal_L17 37..121 CDD:279529 44/83 (53%)
Mrpl17NP_079577.1 Ribosomal_L17 28..126 CDD:279529 46/98 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7795
eggNOG 1 0.900 - - E1_COG0203
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H32526
Inparanoid 1 1.050 111 1.000 Inparanoid score I4866
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55569
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003177
OrthoInspector 1 1.000 - - oto91991
orthoMCL 1 0.900 - - OOG6_100929
Panther 1 1.100 - - LDO PTHR14413
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1152
SonicParanoid 1 1.000 - - X5446
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.