DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL17 and mrpl-17

DIOPT Version :9

Sequence 1:NP_001261196.1 Gene:mRpL17 / 38046 FlyBaseID:FBgn0035122 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_491114.2 Gene:mrpl-17 / 171889 WormBaseID:WBGene00021829 Length:194 Species:Caenorhabditis elegans


Alignment Length:187 Identity:60/187 - (32%)
Similarity:93/187 - (49%) Gaps:22/187 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MSQLRIAV-----------RPNKRHLKNVD-GPEGRLLKLRKTVTALVKHERIELFYNRADEARG 62
            ||..|:||           .|.|.....:: ....||..||:.||..|:.||.||.:|||.|||.
 Worm     1 MSAHRVAVSLPRIGVTIGHAPQKLKTGGIEPSRRARLEVLRRIVTRTVREERAELKWNRAVEARP 65

  Fly    63 YAELLISNAIRHGDRHQATMELADYWLLEKQLVHKLFKVLVPRYETYNVSYTRMYKAP--REYPG 125
            |.|.||...:..|...:.|.|:.::||.||.|:.|:.:|:|||::..:..:|.:::.|  |....
 Worm    66 YLERLIQLGVERGPLDEYTAEMMEWWLPEKDLITKMHEVIVPRFQDRDSPFTSLFRLPPQRLQQF 130

  Fly   126 IYYRR--------SVLELRGNPYPSLAADHSQNRNLLHNVLLDEARKEFRRQKLSEL 174
            |..:|        .|||:.|||:|.:.||.......:.:|||.:|.:..::....:|
 Worm   131 IQNKREVWKRYDIGVLEIDGNPFPQIQADRVDQSESILDVLLADALRNHQKNLQEKL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL17NP_001261196.1 Ribosomal_L17 37..121 CDD:279529 34/85 (40%)
mrpl-17NP_491114.2 Ribosomal_L17 40..126 CDD:294255 34/85 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I6180
eggNOG 1 0.900 - - E1_COG0203
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I3692
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55569
OrthoDB 1 1.010 - - D1540433at2759
OrthoFinder 1 1.000 - - FOG0003177
OrthoInspector 1 1.000 - - oto17430
orthoMCL 1 0.900 - - OOG6_100929
Panther 1 1.100 - - LDO PTHR14413
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1152
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.