DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tudor-SN and LCL3

DIOPT Version :9

Sequence 1:NP_001261195.1 Gene:Tudor-SN / 38045 FlyBaseID:FBgn0035121 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_011430.1 Gene:LCL3 / 852795 SGDID:S000003053 Length:274 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:46/151 - (30%)
Similarity:70/151 - (46%) Gaps:22/151 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   545 ASGSRLRIFVP----KDSCLVTFLLAGISCPRSSRPALNGVPAQEGEPFGDEALTFTRERVLQRD 605
            |....|::.||    |:...:...|.||..|..   |..|.|||   |||:|||.:.:.|:|.:.
Yeast   128 AKSQFLKLNVPYKNRKNLPTIPIRLCGIDAPER---AHFGNPAQ---PFGNEALIWLQNRILGKK 186

  Fly   606 VSV---HIDTTDKAGSSVIGWLWTDSGANLSVALVEEGLAEVHFSAEKSEY------YRQLKIAE 661
            |.|   .||..::..:.|..|.|.....:||:.::::|||.|:.....:|:      ||..   |
Yeast   187 VWVKPLSIDQYNRCVARVSYWDWFGGWKDLSLEMLKDGLAVVYEGKVNTEFDDREDKYRYY---E 248

  Fly   662 DRAKAAKKNIWTNYVEEVPKE 682
            ..|::.||.:|.....|.|.|
Yeast   249 FLARSRKKGLWIQNKFETPGE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tudor-SNNP_001261195.1 SNc 23..166 CDD:214615
SNc 195..333 CDD:214615
SNc 346..504 CDD:320778
SNc 538..672 CDD:214615 42/139 (30%)
TUDOR 697..817 CDD:306940
SNc 767..914 CDD:320778
LCL3NP_011430.1 SNase 149..261 CDD:395448 38/120 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I3077
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto100269
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1361
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.