DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tudor-SN and Tudor1

DIOPT Version :10

Sequence 1:NP_612021.1 Gene:Tudor-SN / 38045 FlyBaseID:FBgn0035121 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_001154697.2 Gene:Tudor1 / 830626 AraportID:AT5G07350 Length:1007 Species:Arabidopsis thaliana


Alignment Length:50 Identity:16/50 - (32%)
Similarity:22/50 - (44%) Gaps:8/50 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 VRNKVDIEAYAPPPELLQILPPKSTIRTSSGSQIGPNNPKFVPGMQALLD 207
            |.|||.:..:   |..:..|.|   :.|.|.....|.||.  |.:||.:|
plant   180 VSNKVPVVQH---PHHVHPLTP---LITYSNEHFTPGNPP--PHLQADVD 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tudor-SNNP_612021.1 SNc 23..166 CDD:214615 4/7 (57%)
SNc 195..333 CDD:214615 5/12 (42%)
SNc 346..504 CDD:469627
SNc 538..672 CDD:214615
Tudor_TDRD11 723..805 CDD:410504
YncB <868..926 CDD:441134
Tudor1NP_001154697.2 SNc 37..151 CDD:469627
SNc 186..364 CDD:469627 11/43 (26%)
SNc 378..556 CDD:469627
SNc 587..712 CDD:469627
Tudor_AtTudor1-like 747..862 CDD:410514
SNc 860..968 CDD:469627
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.