DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tudor-SN and SPBC19F8.04c

DIOPT Version :9

Sequence 1:NP_001261195.1 Gene:Tudor-SN / 38045 FlyBaseID:FBgn0035121 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_596346.1 Gene:SPBC19F8.04c / 2540556 PomBaseID:SPBC19F8.04c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:167 Identity:41/167 - (24%)
Similarity:66/167 - (39%) Gaps:49/167 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 IEHVRDGSTVRAFLLP-----DFHY---------------ITLMISGIRCPGVKLDADGKPDLSV 245
            :..|.||...|.:..|     .:|:               |::.::||..|  :....||.:   
pombe    61 VTRVGDGDNFRFYHTPGGRLLGWHWLRKVPCSRSDLSNETISVRLAGIDAP--ESAHFGKQE--- 120

  Fly   246 KVPFADEARYYVETRLLQRDVEI---------RLESVNNSNFIGTILYP------KGNIAESLLR 295
             .|:|.||:.::..:|..:.|.|         ||.:       |...||      |.:|...::|
pombe   121 -QPYALEAKEFLHNKLYHKSVRIIPLKIDRYARLVA-------GVQYYPIPHFFWKKDIGPQMIR 177

  Fly   296 EGLAKCVDWSMAVM-KTGTDKLRAAERFAKEKRLRQW 331
            :|||...:.|..|. .|..:.|.|.|..||:|:|..|
pombe   178 KGLAVVYEGSDGVFCPTKKECLLALEIVAKKKKLSLW 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tudor-SNNP_001261195.1 SNc 23..166 CDD:214615
SNc 195..333 CDD:214615 41/167 (25%)
SNc 346..504 CDD:320778
SNc 538..672 CDD:214615
TUDOR 697..817 CDD:306940
SNc 767..914 CDD:320778
SPBC19F8.04cNP_596346.1 SNc 55..216 CDD:214615 41/167 (25%)
SNase 102..216 CDD:278963 34/126 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1525
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1361
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.