DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and ANKRD44

DIOPT Version :9

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001354424.1 Gene:ANKRD44 / 91526 HGNCID:25259 Length:1074 Species:Homo sapiens


Alignment Length:343 Identity:103/343 - (30%)
Similarity:168/343 - (48%) Gaps:34/343 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SVFGSVENTLFLLKHYNADPNVADSRGRTPLHFACCRANAPIAKVLLDFG----ADPNRWDARKE 167
            ::|......:.:|.|...|.|..||..|||||.|....:|.|.::|:..|    |..|.|     
Human    15 AIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKDNMW----- 74

  Fly   168 VTSLHCAASSKSVECILLLLRRKASINIGIEK-RSALHYAIDVNAVDCVEILLKYGADPNTPQVY 231
            :|.||.|.:|:|.|.:.:|::..|.:|...:. ::.||.|....||.|.|:::...:..|.....
Human    75 LTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRG 139

  Fly   232 TETPLHTASAAGFAKCVQLLLSHNADVRSQFGEGKVTALHLAAENDYVECARLLLEHRAEVDCRN 296
            ..|.||.|:..|..:.|.|||:..|::.: |.:....|||.||...:::...||:.|.|||.|::
Human   140 GRTALHHAALNGHVEMVNLLLAKGANINA-FDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKD 203

  Fly   297 ASHQTPLHLACLSQSIGTVDLLISYGANVNAVYRDGRTALHAAIVKQSRSLDCCNALLKAGADVN 361
            ....||||.|..:..|..|..|::.|..::.:...|.||||.|......::  .|.|:..||:||
Human   204 KKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAV--VNELIDYGANVN 266

  Fly   362 KADNYGYTPLHIAALNEFSS-CVYTFIEHGADITART-DGR----VSALSFIVRRTPEIIPKLMQ 420
            :.:|.|:||||.||.:...: |:...:.:|||:..:: ||:    ::|:.....|:..:|     
Human   267 QPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLI----- 326

  Fly   421 KLDSSIKANDQEIGDVDC 438
                      |..|::||
Human   327 ----------QNGGEIDC 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_4 99..153 CDD:290365 15/45 (33%)
ANK repeat 102..130 CDD:293786 5/22 (23%)
ANK 127..252 CDD:238125 41/129 (32%)
ANK repeat 132..163 CDD:293786 12/34 (35%)
Ank_2 137..226 CDD:289560 27/93 (29%)
ANK repeat 166..196 CDD:293786 10/29 (34%)
ANK 198..319 CDD:238125 38/121 (31%)
ANK repeat 200..229 CDD:293786 8/28 (29%)
Ank_2 203..296 CDD:289560 31/92 (34%)
ANK repeat 231..262 CDD:293786 10/30 (33%)
ANK 268..387 CDD:238125 42/119 (35%)
ANK repeat 268..296 CDD:293786 12/27 (44%)
Ank_2 270..364 CDD:289560 32/93 (34%)
ANK repeat 298..329 CDD:293786 9/30 (30%)
ANK repeat 331..364 CDD:293786 12/32 (38%)
Ank_5 353..404 CDD:290568 19/56 (34%)
ANK repeat 366..396 CDD:293786 11/30 (37%)
Ion_trans 556..734 CDD:278921
ANKRD44NP_001354424.1 ANK 1 7..36 4/20 (20%)
ANK 2 40..69 10/28 (36%)
ANK 3 73..102 10/33 (30%)
ANK 4 106..135 7/28 (25%)
ANK 5 139..168 10/28 (36%)
ANK 6 172..201 11/28 (39%)
ANK 7 205..234 9/28 (32%)
ANK 8 238..267 11/30 (37%)
ANK 9 271..301 11/29 (38%)
ANK 10 305..334 7/43 (16%)
ANK 11 338..367
ANK 13 422..451
ANK 14 455..484
ANK 15 488..516
ANK 16 549..579
ANK 17 584..613
ANK 18 617..646
ANK 19 651..680
ANK 20 687..716
ANK 21 720..749
ANK 22 753..782
ANK 23 789..818
ANK 24 821..850
ANK 25 856..885
ANK 26 889..919
ANK 27 923..952
ANK 28 959..988
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3394
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.