DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and YAR1

DIOPT Version :9

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_015085.1 Gene:YAR1 / 855837 SGDID:S000006160 Length:200 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:37/147 - (25%)
Similarity:54/147 - (36%) Gaps:45/147 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 EGKVTALHLAAENDYVECARLLLEHRAEVDCRNASHQTPLHLACLSQSIGTVDLLISYGANVNAV 328
            |...||||:||.|.::|..|.:||                   .:|::....||    .|.||.|
Yeast    48 ESDSTALHMAAANGHIETVRYILE-------------------TVSRANSAEDL----KAFVNEV 89

  Fly   329 YRDGRTALHAAIVKQSRSLDCCNALLKAGADVNKADNYGYTPLHIAALNEFSSCVYTFIEHGADI 393
            .:.|.||||.|.:  :..||....|         .|.|...|.   ..|:|.        |.|..
Yeast    90 NKTGNTALHWASL--NGKLDVVKLL---------CDEYEADPF---IRNKFG--------HDAIF 132

  Fly   394 TARTDGRVSALSFIVRR 410
            .|...|:....::.:::
Yeast   133 EAENSGKEEVETYFLKK 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_4 99..153 CDD:290365
ANK repeat 102..130 CDD:293786
ANK 127..252 CDD:238125
ANK repeat 132..163 CDD:293786
Ank_2 137..226 CDD:289560
ANK repeat 166..196 CDD:293786
ANK 198..319 CDD:238125 15/54 (28%)
ANK repeat 200..229 CDD:293786
Ank_2 203..296 CDD:289560 12/31 (39%)
ANK repeat 231..262 CDD:293786
ANK 268..387 CDD:238125 32/118 (27%)
ANK repeat 268..296 CDD:293786 11/27 (41%)
Ank_2 270..364 CDD:289560 25/93 (27%)
ANK repeat 298..329 CDD:293786 6/30 (20%)
ANK repeat 331..364 CDD:293786 9/32 (28%)
Ank_5 353..404 CDD:290568 10/50 (20%)
ANK repeat 366..396 CDD:293786 6/29 (21%)
Ion_trans 556..734 CDD:278921
YAR1NP_015085.1 ANK repeat 11..47 CDD:293786
Ank_2 20..124 CDD:403870 31/112 (28%)
ANK repeat 49..90 CDD:293786 17/63 (27%)
ANK repeat 92..124 CDD:293786 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2336
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.