| Sequence 1: | NP_612015.1 | Gene: | pyx / 38037 | FlyBaseID: | FBgn0035113 | Length: | 956 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001300666.1 | Gene: | Asb11 / 68854 | MGIID: | 1916104 | Length: | 323 | Species: | Mus musculus |
| Alignment Length: | 219 | Identity: | 69/219 - (31%) |
|---|---|---|---|
| Similarity: | 105/219 - (47%) | Gaps: | 19/219 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 134 RTPLHFACCRANAPIAKVLLDFGADPNRWDARKEVTSLHCAASSKSVECILLLLRRKASINI-GI 197
Fly 198 EKRSALHYAIDVNAVDCVEILLKYGADPNTPQVYTETPLHTASAAGFAKCVQLLLSHNADVRS-- 260
Fly 261 -QFGEGKVTALHLAAENDYVECARLLLEHRAEVDCRNASH----QTPLHLACLSQSIGTVDLLIS 320
Fly 321 YGANVNAVYRDGRTALHAAIVKQS 344 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| pyx | NP_612015.1 | Ank_4 | 99..153 | CDD:290365 | 6/18 (33%) |
| ANK repeat | 102..130 | CDD:293786 | |||
| ANK | 127..252 | CDD:238125 | 34/118 (29%) | ||
| ANK repeat | 132..163 | CDD:293786 | 9/28 (32%) | ||
| Ank_2 | 137..226 | CDD:289560 | 26/89 (29%) | ||
| ANK repeat | 166..196 | CDD:293786 | 11/30 (37%) | ||
| ANK | 198..319 | CDD:238125 | 37/127 (29%) | ||
| ANK repeat | 200..229 | CDD:293786 | 8/28 (29%) | ||
| Ank_2 | 203..296 | CDD:289560 | 29/95 (31%) | ||
| ANK repeat | 231..262 | CDD:293786 | 8/33 (24%) | ||
| ANK | 268..387 | CDD:238125 | 31/81 (38%) | ||
| ANK repeat | 268..296 | CDD:293786 | 11/27 (41%) | ||
| Ank_2 | 270..364 | CDD:289560 | 30/79 (38%) | ||
| ANK repeat | 298..329 | CDD:293786 | 14/34 (41%) | ||
| ANK repeat | 331..364 | CDD:293786 | 6/14 (43%) | ||
| Ank_5 | 353..404 | CDD:290568 | |||
| ANK repeat | 366..396 | CDD:293786 | |||
| Ion_trans | 556..734 | CDD:278921 | |||
| Asb11 | NP_001300666.1 | ANK 1 | 64..93 | 8/26 (31%) | |
| ANK | 66..183 | CDD:238125 | 34/118 (29%) | ||
| Ank_4 | 66..118 | CDD:290365 | 16/52 (31%) | ||
| ANK repeat | 66..95 | CDD:293786 | 9/28 (32%) | ||
| ANK repeat | 97..128 | CDD:293786 | 11/31 (35%) | ||
| ANK 2 | 97..126 | 10/29 (34%) | |||
| Ank_2 | 102..189 | CDD:289560 | 25/87 (29%) | ||
| ANK 3 | 130..159 | 8/28 (29%) | |||
| ANK repeat | 130..155 | CDD:293786 | 6/24 (25%) | ||
| ANK 4 | 162..191 | 8/28 (29%) | |||
| ANK | 165..269 | CDD:238125 | 37/112 (33%) | ||
| ANK repeat | 165..193 | CDD:293786 | 7/27 (26%) | ||
| Ank_2 | 167..258 | CDD:289560 | 33/99 (33%) | ||
| ANK repeat | 195..225 | CDD:293786 | 13/38 (34%) | ||
| ANK 5 | 195..224 | 13/37 (35%) | |||
| ANK repeat | 227..258 | CDD:293786 | 13/30 (43%) | ||
| ANK 6 | 227..256 | 12/28 (43%) | |||
| ANK 7 | 260..289 | 6/14 (43%) | |||
| SOCS | 282..323 | CDD:295349 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||