DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and asb16

DIOPT Version :9

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001035458.1 Gene:asb16 / 678621 ZFINID:ZDB-GENE-031031-3 Length:428 Species:Danio rerio


Alignment Length:335 Identity:89/335 - (26%)
Similarity:130/335 - (38%) Gaps:79/335 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 KEVTSLHCAASSKSVECILLLLRRKASINIGIEKRSALHYAIDVNAVDCVEILLKYGADPNTPQV 230
            |:.::|..|||.....|:..||.|.|.::.....|:|||.|.......||.:||.:.|||:...:
Zfish    85 KQTSALRLAASRGHSACVEELLFRGAEVDADPGGRTALHDACSGGHDVCVRLLLDHAADPDLLAM 149

  Fly   231 YTETPLHTASAAGFAKCVQLLLSHNADVRSQFGEGKVTALHLAAENDYVECARLLLEHRAEVDCR 295
            ....|||..:|....:|.:||:|..|.|.....:..:|.||:|       |.|.|.||       
Zfish   150 DGNAPLHLCNAPHTYQCAELLVSSGALVNVAQRDSCLTPLHVA-------CRRGLEEH------- 200

  Fly   296 NASHQTPLHLACLSQSIGTVDLLISYGANVNAVYRDGRTALHAAI------VKQSRSLDCCNALL 354
                               |:|.:|||.:|.|..::|.|.|:||.      .:..|.|.....||
Zfish   201 -------------------VELYLSYGGDVMARSQEGETPLNAACAGAERPAEMGRYLRIVQNLL 246

  Fly   355 KAGADVNKADNYGYTPLHIAALNEFSSCVYTFIEHGADITARTDGR-------VSALSFIVRRTP 412
            .||||........:|.||.|..|.....|...:|||    ||.|..       :..|..::...|
Zfish   247 AAGADAQTCGRKKHTALHNACGNCCPRIVKLLLEHG----ARADVENCAGYTPMDCLLQVIEDYP 307

  Fly   413 EIIPKLMQKLDSSIKANDQEIGDVDCQIKLDFRLLVPSSSMDRGETELLLSLIEVGQKRILMH-- 475
            |..|:::                  .|..|::....||..|      |.|.|..:....::::  
Zfish   308 EQQPEIV------------------AQFLLNYGAKPPSPRM------LKLCLPSLATLEVMLNCY 348

  Fly   476 ---PLCETFL 482
               |.||.:|
Zfish   349 PVIPACEEWL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_4 99..153 CDD:290365
ANK repeat 102..130 CDD:293786
ANK 127..252 CDD:238125 28/85 (33%)
ANK repeat 132..163 CDD:293786
Ank_2 137..226 CDD:289560 21/59 (36%)
ANK repeat 166..196 CDD:293786 10/29 (34%)
ANK 198..319 CDD:238125 33/120 (28%)
ANK repeat 200..229 CDD:293786 12/28 (43%)
Ank_2 203..296 CDD:289560 29/92 (32%)
ANK repeat 231..262 CDD:293786 10/30 (33%)
ANK 268..387 CDD:238125 35/124 (28%)
ANK repeat 268..296 CDD:293786 9/27 (33%)
Ank_2 270..364 CDD:289560 28/99 (28%)
ANK repeat 298..329 CDD:293786 7/30 (23%)
ANK repeat 331..364 CDD:293786 13/38 (34%)
Ank_5 353..404 CDD:290568 18/57 (32%)
ANK repeat 366..396 CDD:293786 9/29 (31%)
Ion_trans 556..734 CDD:278921
asb16NP_001035458.1 ANK 88..203 CDD:238125 41/147 (28%)
ANK repeat 88..115 CDD:293786 9/26 (35%)
Ank_2 90..179 CDD:289560 31/88 (35%)
ANK repeat 117..148 CDD:293786 12/30 (40%)
ANK repeat 150..179 CDD:293786 10/28 (36%)
ANK 187..298 CDD:238125 41/147 (28%)
ANK repeat 187..215 CDD:293786 16/60 (27%)
Ank_2 189..289 CDD:289560 40/136 (29%)
ANK repeat 217..256 CDD:293786 13/38 (34%)
ANK repeat 258..289 CDD:293786 12/34 (35%)
Ank_2 263..>325 CDD:289560 17/83 (20%)
ANK repeat 291..323 CDD:293786 6/49 (12%)
SOCS_ASB4_ASB18 381..428 CDD:239693
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.