DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment pyx and SOWAHC

DIOPT Version :9

Sequence 1:	NP_612015.1	Gene:	pyx / 38037	FlyBaseID:	FBgn0035113	Length:	956	Species:	Drosophila melanogaster
Sequence 2:	NP_075392.2	Gene:	SOWAHC / 65124	HGNCID:	26149	Length:	525	Species:	Homo sapiens

Alignment Length:	118	Identity:	34/118 - (28%)
Similarity:	55/118 - (46%)	Gaps:	16/118 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   240 SAAGFAKCVQLLLSHNADVRSQFGEGKVTALHLAAENDYVECARLLL----EHR--AEVDCRNAS 298
            |..|...|...||     |:..|..| .|.||.||::...|...:|:    :|:  ..:|.|.:.
Human   282 SLEGLLTCEPGLL-----VKRDFITG-FTCLHWAAKHGRQELLAMLVNFANKHQLPVNIDARTSG 340

  Fly   299 HQTPLHLACLSQSIGTVDLLI-SYGANVNAVYRDGRTA---LHAAIVKQSRSL 347
            ..|.||||.:...:..|.||: :|.|:|:.....|:.|   |..:|.::.::|
Human   341 GYTALHLAAMHGHVEVVKLLVGAYDADVDIRDYSGKKASQYLSRSIAEEIKNL 393

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
pyx	NP_612015.1	Ank_4	99..153	CDD:290365
		ANK repeat	102..130	CDD:293786
		ANK	127..252	CDD:238125	3/11 (27%)
		ANK repeat	132..163	CDD:293786
		Ank_2	137..226	CDD:289560
		ANK repeat	166..196	CDD:293786
		ANK	198..319	CDD:238125	25/84 (30%)
		ANK repeat	200..229	CDD:293786
		Ank_2	203..296	CDD:289560	17/61 (28%)
		ANK repeat	231..262	CDD:293786	6/21 (29%)
		ANK	268..387	CDD:238125	26/90 (29%)
		ANK repeat	268..296	CDD:293786	9/33 (27%)
		Ank_2	270..364	CDD:289560	25/88 (28%)
		ANK repeat	298..329	CDD:293786	11/31 (35%)
		ANK repeat	331..364	CDD:293786	5/20 (25%)
		Ank_5	353..404	CDD:290568
		ANK repeat	366..396	CDD:293786
		Ion_trans	556..734	CDD:278921
SOWAHC	NP_075392.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	84..263
		Ank_2	272..372	CDD:289560	29/95 (31%)
		ANK	301..>375	CDD:238125	22/74 (30%)
		ANK 1	301..330		9/29 (31%)
		ANK repeat	302..338	CDD:293786	10/36 (28%)
		ANK repeat	340..372	CDD:293786	11/31 (35%)
		ANK 2	340..370		11/29 (38%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	434..525
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R2336
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.030