DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and anks1b

DIOPT Version :9

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:XP_017210541.1 Gene:anks1b / 565408 ZFINID:ZDB-GENE-041210-349 Length:1281 Species:Danio rerio


Alignment Length:241 Identity:74/241 - (30%)
Similarity:110/241 - (45%) Gaps:22/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 NVADSRGRTPLHFACCRANAPIAKVLLDFGADPNRWDARKEVTSLHCAASSKSVECILLLLRRKA 191
            |..|..|.||||.|....:..:...||.|.|..|..|: |....||.||....|:.:.:|:....
Zfish    52 NCVDGSGYTPLHHASLNGHRDVVLKLLQFEASTNVSDS-KGCFPLHLAAWRGDVDIVQILIHHGP 115

  Fly   192 S---IN-IGIEKRSALHYAIDVNAVDCVEILLKYGADPNTPQVYTETPLHTASAAGFAKCVQLLL 252
            |   :| ..:||.:|||.|......:.|.:||:...||:......||||..|:..|..:.|::||
Zfish   116 SHSRVNEQNLEKETALHCAAQYGHSEVVRVLLQELTDPSMRNSRGETPLDLAALYGRLQVVRMLL 180

  Fly   253 SHNADVRSQFGEGKVTALHLAAENDYVECARLLLEHRAEVDCRNASHQ-TPLHLACLSQSIGTVD 316
            :.:.::.| ....|.|.|||||.|.:....::|||  |::|....:.: :.||.|.|...:..|.
Zfish   181 TAHPNLMS-CNTRKHTPLHLAARNGHYATVQVLLE--ADMDVNTQTEKGSALHEAALFGKMDVVQ 242

  Fly   317 LLISYGANVNAVYRDGRTALH-------------AAIVKQSRSLDC 349
            ||:..|.:.|.....|||||.             |:::......||
Zfish   243 LLLDSGIDANIRDCQGRTALDILREHPSQKSQQIASLIHDYMMSDC 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_4 99..153 CDD:290365 8/25 (32%)
ANK repeat 102..130 CDD:293786 1/2 (50%)
ANK 127..252 CDD:238125 41/128 (32%)
ANK repeat 132..163 CDD:293786 11/30 (37%)
Ank_2 137..226 CDD:289560 28/92 (30%)
ANK repeat 166..196 CDD:293786 9/33 (27%)
ANK 198..319 CDD:238125 40/121 (33%)
ANK repeat 200..229 CDD:293786 9/28 (32%)
Ank_2 203..296 CDD:289560 31/92 (34%)
ANK repeat 231..262 CDD:293786 10/30 (33%)
ANK 268..387 CDD:238125 29/96 (30%)
ANK repeat 268..296 CDD:293786 12/27 (44%)
Ank_2 270..364 CDD:289560 28/94 (30%)
ANK repeat 298..329 CDD:293786 9/31 (29%)
ANK repeat 331..364 CDD:293786 8/32 (25%)
Ank_5 353..404 CDD:290568
ANK repeat 366..396 CDD:293786
Ion_trans 556..734 CDD:278921
anks1bXP_017210541.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1976
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.