DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and ankrd52a

DIOPT Version :10

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001018164.1 Gene:ankrd52a / 553206 ZFINID:ZDB-GENE-050522-247 Length:1071 Species:Danio rerio


Alignment Length:350 Identity:101/350 - (28%)
Similarity:160/350 - (45%) Gaps:63/350 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LLKHYNADPNVADSRGRTPLHFACCRANAPIAKVLLDFGADPNRWDARKEVTSLHCAASSKSVEC 182
            ||.:..|:.:.:|.:.|.|:|:|....:..:.|:|:..|:|.:..| ::..|.||.||:|..|:.
Zfish   158 LLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKD-KRGYTPLHAAAASGHVDV 221

  Fly   183 ILLLLRRKASIN----IGIEKRSALHYAIDVNAVDCVEILLKYGADPNTPQVYTETPLHTAS-AA 242
            :..|||..|.|:    .|   .:|||.|...........|:..||:.|.|.....||||.|: :.
Zfish   222 VKYLLRNGAEIDEPNAFG---NTALHVACYTGQEAVANELVNRGANVNQPNHRGYTPLHLAAVST 283

  Fly   243 GFAKCVQLLLSHNADVRSQFGEGKVTALHLAAENDYVECARLLLEHRAEVDCRNASHQTPLHLA- 306
            ..|.|::||:::.|||..|..||| :.||:||.:.....:::|:::..|:||.:....||||:| 
Zfish   284 NGALCLELLVNNGADVNMQSKEGK-SPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAA 347

  Fly   307 ---------------------------------------CLSQSIGTVDL-----------LISY 321
                                                   |..:.:.:..|           ::|.
Zfish   348 KYGHELLISTLMTNGADTARQGIHGMFPLHLAVLYGSSDCCRKLLSSGQLYSIVLSMSKEHVLSA 412

  Fly   322 GANVNAVYRDGRTALHAAIVKQSRSLDCCNALLKAGADVNKADNYGYTPLHIAALNEFSSCVYTF 386
            |.::|.....|||.||||  ....:::|.|.||.:|||:||.|.:|.||||.||.|....||...
Zfish   413 GFDINTPDNFGRTCLHAA--ASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVL 475

  Fly   387 IEHGADITARTDGRVSALSFIVRRT 411
            :..||::..|.....:.|.:....|
Zfish   476 VGAGAEVNERDRSGCTPLHYSAAST 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_2 88..161 CDD:463710 12/42 (29%)
ANK repeat 102..130 CDD:293786 3/11 (27%)
ANK repeat 132..163 CDD:293786 8/30 (27%)
ANKYR 148..435 CDD:440430 92/319 (29%)
ANK repeat 166..196 CDD:293786 12/33 (36%)
ANK repeat 200..229 CDD:293786 8/28 (29%)
ANK repeat 231..262 CDD:293786 12/31 (39%)
ANK repeat 268..296 CDD:293786 8/27 (30%)
ANK repeat 298..329 CDD:293786 10/81 (12%)
ANK repeat 331..364 CDD:293786 16/32 (50%)
ANK repeat 366..396 CDD:293786 12/29 (41%)
Ion_trans <562..734 CDD:459842
ankrd52aNP_001018164.1 ANK 1 7..36
Ank_4 10..61 CDD:372654
ANK repeat 11..38 CDD:293786
ANK 2 40..69
ANK repeat 42..71 CDD:293786
ANKYR 56..343 CDD:440430 60/189 (32%)
ANK 3 73..102
ANK repeat 76..104 CDD:293786
ANK repeat 106..137 CDD:293786
ANK 4 106..135
ANK 5 139..168 3/9 (33%)
ANK repeat 140..170 CDD:293786 3/11 (27%)
ANK 6 172..201 8/28 (29%)
ANK repeat 176..203 CDD:293786 7/26 (27%)
ANK repeat 205..236 CDD:293786 12/30 (40%)
ANK 7 205..234 12/28 (43%)
ANK 8 238..267 8/31 (26%)
ANK repeat 238..266 CDD:293786 8/30 (27%)
ANK repeat 271..302 CDD:293786 12/30 (40%)
ANK 9 271..301 12/29 (41%)
ANKYR 289..602 CDD:440430 58/214 (27%)
ANK repeat 305..336 CDD:293786 11/31 (35%)
ANK 10 305..334 9/29 (31%)
ANK 11 338..367 5/28 (18%)
ANK repeat 338..363 CDD:293786 5/24 (21%)
ANK 12 371..400 2/28 (7%)
ANK repeat 375..420 CDD:293786 5/44 (11%)
ANK repeat 422..453 CDD:293786 16/32 (50%)
ANK 13 422..451 14/30 (47%)
ANK repeat 455..486 CDD:293786 12/30 (40%)
ANK 14 455..484 12/28 (43%)
ANK repeat 488..541 CDD:293786 1/12 (8%)
ANK 15 488..539 1/12 (8%)
ANKYR 530..771 CDD:440430
ANK 16 543..573
ANK repeat 544..576 CDD:293786
ANK repeat 578..609 CDD:293786
ANK 17 578..607
ANK 18 611..640
ANK repeat 611..636 CDD:293786
ANK 19 645..674
ANK repeat 647..679 CDD:293786
ANKYR 672..951 CDD:440430
ANK repeat 681..712 CDD:293786
ANK 20 681..710
ANK repeat 714..745 CDD:293786
ANK 21 714..743
ANK repeat 747..778 CDD:293786
ANK 22 747..776
ANK 23 784..814
ANK repeat 816..850 CDD:293786
ANK 24 816..845
ANK repeat 852..883 CDD:293786
ANK 25 852..881
ANK repeat 885..917 CDD:293786
ANK 26 885..915
ANK 27 919..951
Ank_5 944..992 CDD:433530
ANK repeat 955..986 CDD:293786
ANK 28 955..984
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.