DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and asb5b

DIOPT Version :9

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001017753.1 Gene:asb5b / 550449 ZFINID:ZDB-GENE-050417-271 Length:328 Species:Danio rerio


Alignment Length:385 Identity:101/385 - (26%)
Similarity:149/385 - (38%) Gaps:89/385 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 ETLTESPGGKHVVDMVQSGCFLELMTDSADCNLALICCSVFGSVENTLFLLKHYNADPNVADSR- 132
            |.|.|.|.|.:      :..:|.:        ..|.|..:|  |:.:|.:|.|:..   |..:| 
Zfish     3 EILEERPFGSN------TNVYLSI--------FVLFCFKLF--VKISLNILTHFYV---VKGNRK 48

  Fly   133 --------------------GRTPLHFACCRANAPIAKVLLDFGADPNRWDARKEVTSLHCAASS 177
                                .|:|||.|.|:......|.||..|...|.... ..||.||.|...
Zfish    49 EAARIAAEFYDFGQGHRSWADRSPLHEAACQGRLLALKTLLSQGYSANIVTI-DHVTPLHEACLG 112

  Fly   178 KSVECILLLLRRKASIN-IGIEKRSALHYAIDVNAVDCVEILLKYGADPNTPQVYTETPLHTASA 241
            ..|.|...|:...|::| ..|:..:.|..|....:|.|.|:||::||.|. .:|...:|:|.||:
Zfish   113 DHVACARALIEAGANVNATTIDGVTPLFNACSAGSVTCAEVLLEHGAKPQ-GEVCQPSPIHEASS 176

  Fly   242 AGFAKCVQLLLSHNADVRSQFGEGKVTALHLAAENDYVECARLLLEHRAEVDCRNASHQTPLHLA 306
            .|.|.|:..|:|..|||.....       ||.                           |||::|
Zfish   177 KGRAACIDSLISWGADVDFDIP-------HLG---------------------------TPLYIA 207

  Fly   307 CLSQSIGTVDLLISYGANVNAVYRDGR---TALHAAIVKQSRSLDCCNALLKAGADVNKADNYGY 368
            |.||.:.....|:..||||    :.||   |.||||..|.|..:  ...||:.||.:|..:....
Zfish   208 CASQQLQCAQKLLDGGANV----QKGRFLDTPLHAAAQKDSPEI--IKVLLEFGASINARNVELQ 266

  Fly   369 TPLHIAALNEFSSCVYTFIEHGADITARTDGRVSALSFIVRRTPEIIPKLMQKLDSSIKA 428
            .|:..|..:..:..|....|.......:. .|:|..:::.|....:||.|  ||.:.:|:
Zfish   267 KPVETAPPSSTAEAVLLLYEATPQSLCQL-CRLSIRNYMGRSRLHLIPHL--KLPTLLKS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_4 99..153 CDD:290365 16/74 (22%)
ANK repeat 102..130 CDD:293786 8/27 (30%)
ANK 127..252 CDD:238125 42/146 (29%)
ANK repeat 132..163 CDD:293786 12/51 (24%)
Ank_2 137..226 CDD:289560 29/89 (33%)
ANK repeat 166..196 CDD:293786 10/30 (33%)
ANK 198..319 CDD:238125 32/120 (27%)
ANK repeat 200..229 CDD:293786 10/28 (36%)
Ank_2 203..296 CDD:289560 25/92 (27%)
ANK repeat 231..262 CDD:293786 12/30 (40%)
ANK 268..387 CDD:238125 31/121 (26%)
ANK repeat 268..296 CDD:293786 2/27 (7%)
Ank_2 270..364 CDD:289560 28/96 (29%)
ANK repeat 298..329 CDD:293786 12/30 (40%)
ANK repeat 331..364 CDD:293786 14/35 (40%)
Ank_5 353..404 CDD:290568 11/50 (22%)
ANK repeat 366..396 CDD:293786 4/29 (14%)
Ion_trans 556..734 CDD:278921
asb5bNP_001017753.1 ANK 70..187 CDD:238125 40/118 (34%)
ANK repeat 70..99 CDD:293786 11/28 (39%)
Ank_2 73..161 CDD:289560 29/88 (33%)
ANK repeat 101..132 CDD:293786 10/30 (33%)
ANK repeat 134..162 CDD:293786 9/27 (33%)
ANK 169..284 CDD:238125 43/154 (28%)
ANK repeat 169..197 CDD:293786 12/27 (44%)
Ank_2 171..262 CDD:289560 39/130 (30%)
ANK repeat 199..229 CDD:293786 14/60 (23%)
ANK repeat 231..262 CDD:293786 12/32 (38%)
ANK repeat 264..302 CDD:293786 6/38 (16%)
SOCS_ASB5 287..328 CDD:239694 9/40 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.