DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and ASB1

DIOPT Version :9

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001035535.1 Gene:ASB1 / 51665 HGNCID:16011 Length:335 Species:Homo sapiens


Alignment Length:188 Identity:50/188 - (26%)
Similarity:94/188 - (50%) Gaps:29/188 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 TSLHCAASSKSVECILLLLRRKASIN-IGIEKRSALHYAIDVNAVDCVEILLKYGADPNTPQVYT 232
            |.|..||::....|:..|:|:.|.:: :.::.::||:.|:....::..:|||:.|||||..:.:.
Human    80 TPLRIAATAGHGSCVDFLIRKGAEVDLVDVKGQTALYVAVVNGHLESTQILLEAGADPNGSRHHR 144

  Fly   233 ETPLHTASAAGFAKCVQLLLSHNA----------DVRSQFGEGKVTA-----LHLAAENDYVECA 282
            .||::.||..|.|..::.|:.:.|          ||:.:|.. ::|:     |:::|....::|.
Human   145 STPVYHASRVGRADILKALIRYGADVDVNHHLTPDVQPRFSR-RLTSLVVCPLYISAAYHNLQCF 208

  Fly   283 RLLLEHRAEVD--CRNASHQTPLHL---ACLSQSI-------GTVDLLISYGANVNAV 328
            ||||...|..|  |....:....:.   .|:..::       ..|.||:.:|||:|.|
Human   209 RLLLLAGANPDFNCNGPVNTQGFYRGSPGCVMDAVLRHGCEAAFVSLLVEFGANLNLV 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_4 99..153 CDD:290365
ANK repeat 102..130 CDD:293786
ANK 127..252 CDD:238125 25/83 (30%)
ANK repeat 132..163 CDD:293786
Ank_2 137..226 CDD:289560 17/57 (30%)
ANK repeat 166..196 CDD:293786 8/27 (30%)
ANK 198..319 CDD:238125 36/147 (24%)
ANK repeat 200..229 CDD:293786 11/28 (39%)
Ank_2 203..296 CDD:289560 32/109 (29%)
ANK repeat 231..262 CDD:293786 10/40 (25%)
ANK 268..387 CDD:238125 20/78 (26%)
ANK repeat 268..296 CDD:293786 11/34 (32%)
Ank_2 270..364 CDD:289560 19/71 (27%)
ANK repeat 298..329 CDD:293786 9/41 (22%)
ANK repeat 331..364 CDD:293786
Ank_5 353..404 CDD:290568
ANK repeat 366..396 CDD:293786
Ion_trans 556..734 CDD:278921
ASB1NP_001035535.1 Ank_2 22..108 CDD:393464 8/27 (30%)
ANK 1 36..68
ANK repeat 41..70 CDD:293786
ANK 2 77..106 8/25 (32%)
ANK repeat 79..108 CDD:293786 8/27 (30%)
PHA02875 80..>266 CDD:165206 49/186 (26%)
Ank_2 82..173 CDD:372319 26/90 (29%)
ANK repeat 110..141 CDD:293786 11/30 (37%)
ANK 3 110..139 10/28 (36%)
ANK repeat 143..172 CDD:293786 8/28 (29%)
ANK 4 143..172 8/28 (29%)
ANK repeat 174..219 CDD:293786 12/45 (27%)
ANK 5 191..220 8/28 (29%)
ANK 6 235..265 7/29 (24%)
SOCS_ASB1 294..335 CDD:239690
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.