DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and Asb12

DIOPT Version :9

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001032444.1 Gene:Asb12 / 503446 RGDID:1561142 Length:308 Species:Rattus norvegicus


Alignment Length:185 Identity:56/185 - (30%)
Similarity:88/185 - (47%) Gaps:37/185 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 TSLHCAASSKSVECILLLLRRKASI-NIGIEKRSALHYAIDVNAVDCVEILLKYGADPNTPQVYT 232
            |.|..|||...::|:.:||...|.: ::.::.::.|..|:....::||.|||:.||.| :..:|.
  Rat    66 TPLRLAASYGHLDCVKVLLEHGADVDSLDVKAQTPLFTAVSHGHLECVRILLEAGACP-SGSIYN 129

  Fly   233 E-TPLHTASAAGFAKCVQLLLSHNADVRSQFGEGKVTA---------------LHLAAENDYVEC 281
            . :|:.|||..|....:|.||.|.|       |..|.|               |:|||...:::|
  Rat   130 NCSPVLTASRDGAFAILQELLGHGA-------EANVKAKLPVWASNIASCSGPLYLAAVYGHLDC 187

  Fly   282 ARLLLEHRAEVD--C-------RNASHQTPLHLACLSQSIGT--VDLLISYGANV 325
            .||||.:.|:.|  |       |....:|.|.: ||..:...  :.|||.:|||:
  Rat   188 FRLLLLYGADPDYNCIDQALLSRVPQPRTLLEI-CLHHNCEPEYIQLLIDFGANI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_4 99..153 CDD:290365
ANK repeat 102..130 CDD:293786
ANK 127..252 CDD:238125 26/84 (31%)
ANK repeat 132..163 CDD:293786
Ank_2 137..226 CDD:289560 18/57 (32%)
ANK repeat 166..196 CDD:293786 9/27 (33%)
ANK 198..319 CDD:238125 42/147 (29%)
ANK repeat 200..229 CDD:293786 10/28 (36%)
Ank_2 203..296 CDD:289560 36/117 (31%)
ANK repeat 231..262 CDD:293786 11/31 (35%)
ANK 268..387 CDD:238125 24/84 (29%)
ANK repeat 268..296 CDD:293786 13/51 (25%)
Ank_2 270..364 CDD:289560 23/67 (34%)
ANK repeat 298..329 CDD:293786 10/30 (33%)
ANK repeat 331..364 CDD:293786
Ank_5 353..404 CDD:290568
ANK repeat 366..396 CDD:293786
Ion_trans 556..734 CDD:278921
Asb12NP_001032444.1 ANK repeat 66..94 CDD:293786 9/27 (33%)
Ank_2 68..159 CDD:403870 30/98 (31%)
ANK repeat 96..160 CDD:293786 23/71 (32%)
ANK repeat 173..199 CDD:293786 10/25 (40%)
Ank 175..199 CDD:394980 10/23 (43%)
SOCS_box 268..306 CDD:400074
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.