DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and Ank

DIOPT Version :10

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_787122.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster


Alignment Length:434 Identity:126/434 - (29%)
Similarity:198/434 - (45%) Gaps:81/434 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KHVVDMVQSGCFLELMTDSADCNLALICCSVFGSVENTLFLLKHYNADPNVADSRGRTPLHFACC 142
            |.|..:::.|..:...|:|....|.:  .|..|.:...::||:| .|..::...||.||||.| .
  Fly   413 KMVELLIKHGANIGATTESGLTPLHV--ASFMGCINIVIYLLQH-EASADLPTIRGETPLHLA-A 473

  Fly   143 RAN-APIAKVLLDFGADPNRWD--ARKEVTSLHCAASSKSVECILLLLRRKASINI-GIEKRSAL 203
            ||| |.|.::||...    :.|  ||:..|.||.|:...::..|:|||:..|.||. ..:|.|||
  Fly   474 RANQADIIRILLRSA----KVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSAL 534

  Fly   204 HYAIDVNAVDCVEILLKYGADPNTPQVYTETPLHTASAAGFAKCVQLLLSHNADVRSQFGEGKVT 268
            |.|......:.|::||:.||:.|.......||||.|...|....||:||.:.|.:..| |:..||
  Fly   535 HIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQ-GKNDVT 598

  Fly   269 ---------------------------------ALHLAAENDYVECARLLLEHRAEVDCRNASHQ 300
                                             |:|:|.:.:|:|.|..||:|.|:|:..:.|..
  Fly   599 PLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGF 663

  Fly   301 TPLHLACLSQSIGTVDLLISYGANVNAVYRDGRTALHAAIVKQSRSLDCCNALLKAGADVNKADN 365
            :|||||....::..|.||:.||. ::|..::|.|.||.|  .|...:.....||:.||::::...
  Fly   664 SPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVA--AQEGHVLVSQILLEHGANISERTR 725

  Fly   366 YGYTPLHIAALNEFSSCVYTFIEHGADI------------TARTDGRVSALSFIVRR--TPEIIP 416
            .||||||:||.......|..|||:.|||            .|...|.:..::.::|.  .|..:.
  Fly   726 NGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALT 790

  Fly   417 K----------------LMQ--KLDSSIKANDQEIGDVDCQIKL 442
            |                :|:  |:.:|....:..||.::.::|:
  Fly   791 KDGNTALHIASNLGYVTVMESLKIVTSTSVINSNIGAIEEKLKV 834

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_2 88..161 CDD:463710 23/73 (32%)
ANK repeat 102..130 CDD:293786 6/27 (22%)
ANK repeat 132..163 CDD:293786 14/31 (45%)
ANKYR 148..435 CDD:440430 101/354 (29%)
ANK repeat 166..196 CDD:293786 11/30 (37%)
ANK repeat 200..229 CDD:293786 11/28 (39%)
ANK repeat 231..262 CDD:293786 11/30 (37%)
ANK repeat 268..296 CDD:293786 12/60 (20%)
ANK repeat 298..329 CDD:293786 12/30 (40%)
ANK repeat 331..364 CDD:293786 10/32 (31%)
ANK repeat 366..396 CDD:293786 15/41 (37%)
Ion_trans <562..734 CDD:459842
AnkNP_787122.1 ANKYR 20..337 CDD:440430
ANK repeat 72..103 CDD:293786
ANK repeat 105..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK repeat 204..231 CDD:293786
ANKYR 217..502 CDD:440430 30/96 (31%)
ANK repeat 233..264 CDD:293786
ANK repeat 266..295 CDD:293786
ANK repeat 299..330 CDD:293786
ANK repeat 332..363 CDD:293786
ANK repeat 365..395 CDD:293786
ANK repeat 398..427 CDD:293786 3/13 (23%)
ANK repeat 431..462 CDD:293786 8/33 (24%)
ANK repeat 464..494 CDD:293786 15/34 (44%)
ANK repeat 496..527 CDD:293786 11/30 (37%)
ANKYR 510..797 CDD:440430 87/290 (30%)
ANK repeat 529..560 CDD:293786 12/30 (40%)
ANK repeat 562..590 CDD:293786 11/27 (41%)
ANK repeat 595..625 CDD:293786 2/29 (7%)
ANK repeat 628..657 CDD:293786 11/28 (39%)
ANK repeat 661..691 CDD:293786 12/30 (40%)
ANK repeat 693..724 CDD:293786 10/32 (31%)
ANK repeat 726..755 CDD:293786 15/28 (54%)
ANK repeat 759..788 CDD:293786 4/28 (14%)
ZU5 930..1034 CDD:128514
UPA_2 1250..1378 CDD:375346
Death_ank 1439..1521 CDD:260029
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.