DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and Hip14

DIOPT Version :9

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_001261910.1 Gene:Hip14 / 39747 FlyBaseID:FBgn0259824 Length:655 Species:Drosophila melanogaster


Alignment Length:430 Identity:107/430 - (24%)
Similarity:167/430 - (38%) Gaps:132/430 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 IAKV--LLDFGADPNRWDARKEVTSLHCAASSKSVECILLLLRRKASINIGIEKRSALHYAIDVN 210
            ||:|  |::.|.|.|:.|: :.||.||.||                 ||   .:|..:.|.::..
  Fly    58 IARVRELVESGWDVNQPDS-ETVTLLHWAA-----------------IN---NRRDIIRYFLEKG 101

  Fly   211 A-VDCVEILLKYGADPNTPQVYTETPLHTASAAGFAKCVQLLLSHNADVRSQFGEGKVTALHLAA 274
            | ||.|      |.:.|.      ||||.|:..|....|.||::..||.|.:..|| .:.:|:||
  Fly   102 ATVDAV------GGELNA------TPLHWATRQGHLGAVVLLMAAGADPRIRDAEG-CSCIHIAA 153

  Fly   275 ENDYVECARLLLEHRAEVDCRNASHQTPLHLA----CLSQSIGTVDLLISYGANVNAV-YRDGRT 334
            :..:.......:....:.|.::....|.|..|    |   ::..|.||::.|||...| |..|.|
  Fly   154 QFAHTALVAYFIAKGVDPDLQDRGGMTALMWAAWKVC---ALDPVRLLLTLGANPAMVDYTHGNT 215

  Fly   335 ALHAAIVKQSRSLDCCNAL-LKAGADVNKADNYGYTPLHIAALNEFSSCVYTFIEHGADITARTD 398
            |||.||:  :|:....:.| ||:.|.::..:..|.|||  :.|...:..::.    ||.:..|. 
  Fly   216 ALHWAIL--ARNATAISTLVLKSKASLDVPNLRGETPL--SMLESQTGAIWI----GAKVMDRV- 271

  Fly   399 GRVSALSFIVRRTPEIIPKLMQKLDSSIKANDQEI---GDVDCQIKLDFRLLVPSSSMDRGETEL 460
             :.:||:...||:      |:.||     .:|:.:   ..|.|..                 |..
  Fly   272 -KEAALTSQQRRS------LLSKL-----RHDKRLRWWSMVACPF-----------------TAF 307

  Fly   461 LLSLIEVGQKRILMHPLCETFLFLKWRRIRKFFLMSLAY---HTLFVILFT-------------- 508
            .|:.|......:.               |.||||:...|   ||:...||.              
  Fly   308 YLAGIVFTVNTLY---------------IIKFFLLGCLYSIFHTIGKALFDEHLMALLPLSVYLA 357

  Fly   509 ----FYVIW-VYVRCCKKEELCVAPGYVSTIGYLVIILNL 543
                |||.| :|:.        .|..:.:|:.:|:..|.|
  Fly   358 TKAWFYVTWLMYID--------DAVSFTATVCFLISSLLL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_4 99..153 CDD:290365 3/6 (50%)
ANK repeat 102..130 CDD:293786
ANK 127..252 CDD:238125 32/106 (30%)
ANK repeat 132..163 CDD:293786 7/16 (44%)
Ank_2 137..226 CDD:289560 23/80 (29%)
ANK repeat 166..196 CDD:293786 8/29 (28%)
ANK 198..319 CDD:238125 32/125 (26%)
ANK repeat 200..229 CDD:293786 8/29 (28%)
Ank_2 203..296 CDD:289560 25/93 (27%)
ANK repeat 231..262 CDD:293786 12/30 (40%)
ANK 268..387 CDD:238125 33/124 (27%)
ANK repeat 268..296 CDD:293786 4/27 (15%)
Ank_2 270..364 CDD:289560 28/99 (28%)
ANK repeat 298..329 CDD:293786 11/35 (31%)
ANK repeat 331..364 CDD:293786 12/33 (36%)
Ank_5 353..404 CDD:290568 12/51 (24%)
ANK repeat 366..396 CDD:293786 7/29 (24%)
Ion_trans 556..734 CDD:278921
Hip14NP_001261910.1 ANK 52..165 CDD:238125 41/140 (29%)
Ank_2 52..142 CDD:289560 36/116 (31%)
ANK repeat 77..108 CDD:293786 14/56 (25%)
ANK repeat 110..142 CDD:293786 13/37 (35%)
ANK 114..233 CDD:238125 38/124 (31%)
Ank_2 116..209 CDD:289560 26/96 (27%)
ANK repeat 144..175 CDD:293786 6/31 (19%)
ANK repeat 177..209 CDD:293786 10/34 (29%)
Ank_5 198..251 CDD:290568 20/54 (37%)
ANK repeat 212..244 CDD:293786 12/33 (36%)
zf-DHHC 426..559 CDD:279823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24161
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.