Sequence 1: | NP_612015.1 | Gene: | pyx / 38037 | FlyBaseID: | FBgn0035113 | Length: | 956 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099046.1 | Gene: | SOWAHD / 347454 | HGNCID: | 32960 | Length: | 315 | Species: | Homo sapiens |
Alignment Length: | 326 | Identity: | 67/326 - (20%) |
---|---|---|---|
Similarity: | 105/326 - (32%) | Gaps: | 117/326 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 169 TSLHCAASSKSVECILLLLRRKASIN--IGIEKRSALHYAIDVNAVDCVEILLKYGADPNTPQVY 231
Fly 232 TETPLHT---ASAAGFAKCVQLLLSHNAD--VRSQFGEGKVTALHLAAENDYVECARLLLEH--- 288
Fly 289 -----RAEVDCRNASHQTPLHLACLSQSIGTVDLLISYGANVNAVYRDGRTALHAAIVKQSRSLD 348
Fly 349 CCNALLKA-GADVNKADNYGYTPLHIA------ALNEFSSCVYTFIEHGADIT------------ 394
Fly 395 ----------ARTDGRVSALSFIVRRTPEIIPKLMQKLDSSIKANDQEIGDVDCQIKLDFRLLVP 449
Fly 450 S 450 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pyx | NP_612015.1 | Ank_4 | 99..153 | CDD:290365 | |
ANK repeat | 102..130 | CDD:293786 | |||
ANK | 127..252 | CDD:238125 | 16/87 (18%) | ||
ANK repeat | 132..163 | CDD:293786 | |||
Ank_2 | 137..226 | CDD:289560 | 10/58 (17%) | ||
ANK repeat | 166..196 | CDD:293786 | 7/28 (25%) | ||
ANK | 198..319 | CDD:238125 | 28/133 (21%) | ||
ANK repeat | 200..229 | CDD:293786 | 3/28 (11%) | ||
Ank_2 | 203..296 | CDD:289560 | 21/105 (20%) | ||
ANK repeat | 231..262 | CDD:293786 | 8/35 (23%) | ||
ANK | 268..387 | CDD:238125 | 29/133 (22%) | ||
ANK repeat | 268..296 | CDD:293786 | 9/35 (26%) | ||
Ank_2 | 270..364 | CDD:289560 | 23/102 (23%) | ||
ANK repeat | 298..329 | CDD:293786 | 7/30 (23%) | ||
ANK repeat | 331..364 | CDD:293786 | 7/33 (21%) | ||
Ank_5 | 353..404 | CDD:290568 | 17/79 (22%) | ||
ANK repeat | 366..396 | CDD:293786 | 8/57 (14%) | ||
Ion_trans | 556..734 | CDD:278921 | |||
SOWAHD | NP_001099046.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..39 | ||
ANK 1 | 112..141 | 6/28 (21%) | |||
ANK | 147..>231 | CDD:238125 | 27/121 (22%) | ||
ANK 2 | 147..162 | 4/15 (27%) | |||
Ank_2 | <148..218 | CDD:289560 | 24/107 (22%) | ||
ANK repeat | 148..184 | CDD:293786 | 10/38 (26%) | ||
ANK repeat | 186..218 | CDD:293786 | 14/66 (21%) | ||
ANK 3 | 186..216 | 14/64 (22%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2336 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |