| Sequence 1: | NP_612015.1 | Gene: | pyx / 38037 | FlyBaseID: | FBgn0035113 | Length: | 956 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038939690.1 | Gene: | Asb1 / 316628 | RGDID: | 1310760 | Length: | 339 | Species: | Rattus norvegicus |
| Alignment Length: | 217 | Identity: | 56/217 - (25%) |
|---|---|---|---|
| Similarity: | 104/217 - (47%) | Gaps: | 39/217 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 169 TSLHCAASSKSVECILLLLRRKASIN-IGIEKRSALHYAIDVNAVDCVEILLKYGADPNTPQVYT 232
Fly 233 ETPLHTASAAGFAKCVQLLLSHNADV----------RSQFGEGKVTA-----LHLAAENDYVECA 282
Fly 283 RLLLEHRAEVD--CRNASHQTPLHL---ACLSQSI-------GTVDLLISYGANVNAVYRD---- 331
Fly 332 ---GRTALH---AAIVKQSRSL 347 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| pyx | NP_612015.1 | Ank_4 | 99..153 | CDD:290365 | |
| ANK repeat | 102..130 | CDD:293786 | |||
| ANK | 127..252 | CDD:238125 | 25/83 (30%) | ||
| ANK repeat | 132..163 | CDD:293786 | |||
| Ank_2 | 137..226 | CDD:289560 | 18/57 (32%) | ||
| ANK repeat | 166..196 | CDD:293786 | 8/27 (30%) | ||
| ANK | 198..319 | CDD:238125 | 37/147 (25%) | ||
| ANK repeat | 200..229 | CDD:293786 | 12/28 (43%) | ||
| Ank_2 | 203..296 | CDD:289560 | 33/109 (30%) | ||
| ANK repeat | 231..262 | CDD:293786 | 10/40 (25%) | ||
| ANK | 268..387 | CDD:238125 | 25/107 (23%) | ||
| ANK repeat | 268..296 | CDD:293786 | 11/34 (32%) | ||
| Ank_2 | 270..364 | CDD:289560 | 24/100 (24%) | ||
| ANK repeat | 298..329 | CDD:293786 | 8/40 (20%) | ||
| ANK repeat | 331..364 | CDD:293786 | 5/27 (19%) | ||
| Ank_5 | 353..404 | CDD:290568 | |||
| ANK repeat | 366..396 | CDD:293786 | |||
| Ion_trans | 556..734 | CDD:278921 | |||
| Asb1 | XP_038939690.1 | Ank_2 | 26..112 | CDD:423045 | 8/27 (30%) |
| ANK repeat | 45..74 | CDD:293786 | |||
| ANK repeat | 83..112 | CDD:293786 | 8/27 (30%) | ||
| PHA02875 | 84..>270 | CDD:165206 | 50/186 (27%) | ||
| Ank_2 | 86..177 | CDD:403870 | 28/90 (31%) | ||
| ANK repeat | 114..145 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 147..176 | CDD:293786 | 9/28 (32%) | ||
| ANK repeat | 178..223 | CDD:293786 | 11/45 (24%) | ||
| SOCS_ASB1 | 298..339 | CDD:239690 | 1/2 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||