Sequence 1: | NP_612015.1 | Gene: | pyx / 38037 | FlyBaseID: | FBgn0035113 | Length: | 956 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017450378.2 | Gene: | Asb8 / 315287 | RGDID: | 1309246 | Length: | 302 | Species: | Rattus norvegicus |
Alignment Length: | 284 | Identity: | 79/284 - (27%) |
---|---|---|---|
Similarity: | 117/284 - (41%) | Gaps: | 58/284 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 156 GADPNRWDARKEVTSLHCAASSKSVECILLLLRRKASIN-IGIEKRSALHYAIDVNAVDCVEILL 219
Fly 220 KYGADPNTPQVYTETPLHTASAAGFAKCVQLLLSHNADVRSQFGEGKVTALHLAAENDYVECARL 284
Fly 285 LLEHRAEVDCRNASHQTPLHLACLSQSIGTVDLLISYGANVNAVYRDGRTALHAAIVKQSRSL-- 347
Fly 348 ---DCCNALLKAGADVNKADNYGYTPLHIAALNEFSSCVYTFIEHGADITARTDGRVSALSFIVR 409
Fly 410 RT------PEIIPKLMQKLDSSIK 427 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pyx | NP_612015.1 | Ank_4 | 99..153 | CDD:290365 | |
ANK repeat | 102..130 | CDD:293786 | |||
ANK | 127..252 | CDD:238125 | 30/96 (31%) | ||
ANK repeat | 132..163 | CDD:293786 | 4/6 (67%) | ||
Ank_2 | 137..226 | CDD:289560 | 28/70 (40%) | ||
ANK repeat | 166..196 | CDD:293786 | 10/30 (33%) | ||
ANK | 198..319 | CDD:238125 | 37/120 (31%) | ||
ANK repeat | 200..229 | CDD:293786 | 16/28 (57%) | ||
Ank_2 | 203..296 | CDD:289560 | 30/92 (33%) | ||
ANK repeat | 231..262 | CDD:293786 | 3/30 (10%) | ||
ANK | 268..387 | CDD:238125 | 34/123 (28%) | ||
ANK repeat | 268..296 | CDD:293786 | 13/27 (48%) | ||
Ank_2 | 270..364 | CDD:289560 | 30/98 (31%) | ||
ANK repeat | 298..329 | CDD:293786 | 10/30 (33%) | ||
ANK repeat | 331..364 | CDD:293786 | 8/37 (22%) | ||
Ank_5 | 353..404 | CDD:290568 | 9/50 (18%) | ||
ANK repeat | 366..396 | CDD:293786 | 5/29 (17%) | ||
Ion_trans | 556..734 | CDD:278921 | |||
Asb8 | XP_017450378.2 | ANKYR | <70..188 | CDD:223738 | 48/152 (32%) |
ANK repeat | 70..97 | CDD:293786 | 10/26 (38%) | ||
ANK repeat | 99..129 | CDD:293786 | 16/54 (30%) | ||
ANK repeat | 131..162 | CDD:293786 | 15/40 (38%) | ||
ANK repeat | 164..195 | CDD:293786 | 10/30 (33%) | ||
Ank_2 | 169..>229 | CDD:423045 | 16/59 (27%) | ||
SOCS_ASB8 | 259..301 | CDD:239697 | 12/44 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |