DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and Ankrd44

DIOPT Version :10

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:XP_017451840.1 Gene:Ankrd44 / 301415 RGDID:1561893 Length:1074 Species:Rattus norvegicus


Alignment Length:351 Identity:105/351 - (29%)
Similarity:171/351 - (48%) Gaps:34/351 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 CNLALICCSVFGSVENTLFLLKHYNADPNVADSRGRTPLHFACCRANAPIAKVLLDFG----ADP 159
            |:...:..::|......:.||.|...|.|..||..|||||.|....:|.|.::|:..|    |..
  Rat     7 CDQPPLVQAIFSGDPEEIRLLIHKTEDVNALDSEKRTPLHVAAFLGDAEIIELLILSGARVNAKD 71

  Fly   160 NRWDARKEVTSLHCAASSKSVECILLLLRRKASINIGIEK-RSALHYAIDVNAVDCVEILLKYGA 223
            |.|     :|.||.|.:|:|.|.:.:|::..|.:|...:. :|.:|.|....||.|.|:::...:
  Rat    72 NMW-----LTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQSPVHVAAANKAVKCAEVIIPLLS 131

  Fly   224 DPNTPQVYTETPLHTASAAGFAKCVQLLLSHNADVRSQFGEGKVTALHLAAENDYVECARLLLEH 288
            ..|.......|.||.|:..|..:.|.|||:..|::.: |.:....|||.||...:::...||:.|
  Rat   132 SVNVSDRGGRTALHHAALNGHMEMVNLLLAKGANINA-FDKKDRRALHWAAYMGHLDVVALLINH 195

  Fly   289 RAEVDCRNASHQTPLHLACLSQSIGTVDLLISYGANVNAVYRDGRTALHAAIVKQSRSLDCCNAL 353
            .|||.|::....||||.|..:..|..|..|::.|..::.:...|.||||.|......::  .|.|
  Rat   196 GAEVTCKDKKGYTPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAV--VNEL 258

  Fly   354 LKAGADVNKADNYGYTPLHIAALNEFSS-CVYTFIEHGADITART-DGR----VSALSFIVRRTP 412
            :..||:||:.:|.|:||||.||.:...: |:...:.:|||:..:: ||:    ::|:.....|:.
  Rat   259 IDYGANVNQPNNSGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQ 323

  Fly   413 EIIPKLMQKLDSSIKANDQEIGDVDC 438
            .:|               |..|::||
  Rat   324 TLI---------------QNGGEIDC 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_2 88..161 CDD:463710 20/65 (31%)
ANK repeat 102..130 CDD:293786 6/27 (22%)
ANK repeat 132..163 CDD:293786 12/34 (35%)
ANKYR 148..435 CDD:440430 86/297 (29%)
ANK repeat 166..196 CDD:293786 10/29 (34%)
ANK repeat 200..229 CDD:293786 8/28 (29%)
ANK repeat 231..262 CDD:293786 10/30 (33%)
ANK repeat 268..296 CDD:293786 12/27 (44%)
ANK repeat 298..329 CDD:293786 9/30 (30%)
ANK repeat 331..364 CDD:293786 12/32 (38%)
ANK repeat 366..396 CDD:293786 11/30 (37%)
Ion_trans <562..734 CDD:459842
Ankrd44XP_017451840.1 Ank_4 10..61 CDD:372654 16/50 (32%)
ANK repeat 11..38 CDD:293786 6/26 (23%)
ANK repeat 42..71 CDD:293786 11/28 (39%)
ANKYR 54..343 CDD:440430 90/304 (30%)
ANK repeat 73..104 CDD:293786 11/35 (31%)
ANK repeat 140..170 CDD:293786 10/30 (33%)
ANK repeat 172..203 CDD:293786 12/30 (40%)
ANK repeat 205..236 CDD:293786 9/30 (30%)
ANK repeat 238..266 CDD:293786 10/29 (34%)
ANKYR 253..552 CDD:440430 27/99 (27%)
ANK repeat 271..302 CDD:293786 11/30 (37%)
ANK repeat 305..336 CDD:293786 9/45 (20%)
ANK repeat 338..369 CDD:293786
ANK repeat 375..420 CDD:293786
ANK repeat 422..453 CDD:293786
ANK repeat 455..486 CDD:293786
ANK repeat 488..547 CDD:293786
ANKYR 504..767 CDD:440430
ANK repeat 549..580 CDD:293786
ANK repeat 587..615 CDD:293786
ANK repeat 617..685 CDD:293786
ANKYR 668..997 CDD:440430
ANK repeat 687..718 CDD:293786
ANK repeat 720..751 CDD:293786
ANK repeat 789..813 CDD:293786
ANK repeat 821..854 CDD:293786
ANK repeat 857..887 CDD:293786
ANK repeat 889..921 CDD:293786
ANK repeat 923..954 CDD:293786
ANK repeat 959..990 CDD:293786
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.