Sequence 1: | NP_612015.1 | Gene: | pyx / 38037 | FlyBaseID: | FBgn0035113 | Length: | 956 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001373103.1 | Gene: | ANK2 / 287 | HGNCID: | 493 | Length: | 4183 | Species: | Homo sapiens |
Alignment Length: | 456 | Identity: | 125/456 - (27%) |
---|---|---|---|
Similarity: | 191/456 - (41%) | Gaps: | 68/456 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 DEVKETLTE--------SPGGKHVVDMVQSG----CFLELMTDSA-------DCNLALICCSVFG 110
Fly 111 SVENTLFLLKHYNADPNVADSRGRTPLHFACCRANAPIAKVLLDFGADPNRWDARKEVTSLHCAA 175
Fly 176 SSKSVECILLLLRRKASINI-GIEKRSALHYAIDVNAVDCVEILLKYGADPNTPQVYTETPLHTA 239
Fly 240 SAAGFAKCVQLLLSHNA--DVRSQFG---------EGKV---------------------TALHL 272
Fly 273 AAENDYVECARLLLEHRAEVDCRNASHQTPLHLACLSQSIGTVDLLISYGANVNAVYRDGRTALH 337
Fly 338 AAIVKQSRSLDCCNALLKAGADVNKADNYGYTPLHIAALNEFSSCVYTFIEHGADITARTDGRVS 402
Fly 403 ALSFIVRRTPEIIPKLMQKLDSSIKANDQEIGDVDCQIKLDFRLLVPSSSMDRGETELLLSLIEV 467
Fly 468 G 468 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pyx | NP_612015.1 | Ank_4 | 99..153 | CDD:290365 | 16/53 (30%) |
ANK repeat | 102..130 | CDD:293786 | 9/27 (33%) | ||
ANK | 127..252 | CDD:238125 | 42/125 (34%) | ||
ANK repeat | 132..163 | CDD:293786 | 10/30 (33%) | ||
Ank_2 | 137..226 | CDD:289560 | 28/89 (31%) | ||
ANK repeat | 166..196 | CDD:293786 | 10/30 (33%) | ||
ANK | 198..319 | CDD:238125 | 47/152 (31%) | ||
ANK repeat | 200..229 | CDD:293786 | 10/28 (36%) | ||
Ank_2 | 203..296 | CDD:289560 | 40/124 (32%) | ||
ANK repeat | 231..262 | CDD:293786 | 15/32 (47%) | ||
ANK | 268..387 | CDD:238125 | 40/118 (34%) | ||
ANK repeat | 268..296 | CDD:293786 | 12/27 (44%) | ||
Ank_2 | 270..364 | CDD:289560 | 32/93 (34%) | ||
ANK repeat | 298..329 | CDD:293786 | 10/30 (33%) | ||
ANK repeat | 331..364 | CDD:293786 | 11/32 (34%) | ||
Ank_5 | 353..404 | CDD:290568 | 16/50 (32%) | ||
ANK repeat | 366..396 | CDD:293786 | 10/29 (34%) | ||
Ion_trans | 556..734 | CDD:278921 | |||
ANK2 | NP_001373103.1 | Ank_2 | 35..>311 | CDD:423045 | |
ANK repeat | 80..111 | CDD:293786 | |||
ANK repeat | 113..144 | CDD:293786 | |||
ANK repeat | 146..171 | CDD:293786 | |||
Ank_2 | 202..>444 | CDD:423045 | 31/116 (27%) | ||
ANK repeat | 212..247 | CDD:293786 | |||
ANK repeat | 249..280 | CDD:293786 | |||
ANK repeat | 282..313 | CDD:293786 | |||
ANK repeat | 315..345 | CDD:293786 | 5/15 (33%) | ||
ANK repeat | 348..379 | CDD:293786 | 6/30 (20%) | ||
ANK repeat | 381..411 | CDD:293786 | 10/30 (33%) | ||
ANK repeat | 414..445 | CDD:293786 | 10/31 (32%) | ||
PHA03095 | 421..>706 | CDD:222980 | 87/287 (30%) | ||
ANK repeat | 447..478 | CDD:293786 | 10/30 (33%) | ||
ANK repeat | 480..511 | CDD:293786 | 10/30 (33%) | ||
ANK repeat | 513..542 | CDD:293786 | 14/28 (50%) | ||
ANK repeat | 546..571 | CDD:293786 | 4/24 (17%) | ||
Ank_2 | 578..>802 | CDD:423045 | 54/205 (26%) | ||
ANK repeat | 579..604 | CDD:293786 | 9/24 (38%) | ||
ANK repeat | 612..643 | CDD:293786 | 10/30 (33%) | ||
ANK repeat | 645..676 | CDD:293786 | 11/32 (34%) | ||
ANK repeat | 678..707 | CDD:293786 | 10/28 (36%) | ||
ANK repeat | 711..742 | CDD:293786 | 4/40 (10%) | ||
ANK repeat | 744..775 | CDD:293786 | 5/27 (19%) | ||
ANK repeat | 777..806 | CDD:293786 | |||
Ank_4 | 778..830 | CDD:372654 | |||
ZU5 | 1013..1150 | CDD:128514 | |||
UPA_2 | 1371..1500 | CDD:375346 | |||
PspC_subgroup_1 | 1549..>1922 | CDD:411407 | |||
PTZ00449 | <1717..2161 | CDD:185628 | |||
Streccoc_I_II | <1843..>2027 | CDD:411384 | |||
Spc7_N | <2493..>2634 | CDD:373822 | |||
rad2 | <3031..>3565 | CDD:273166 | |||
PRK14949 | <3196..>3442 | CDD:237863 | |||
Death_ank2 | 3614..3697 | CDD:260066 | |||
NESP55 | <3770..>3884 | CDD:115071 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2336 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |