| Sequence 1: | NP_612015.1 | Gene: | pyx / 38037 | FlyBaseID: | FBgn0035113 | Length: | 956 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011542792.1 | Gene: | ANK1 / 286 | HGNCID: | 492 | Length: | 1969 | Species: | Homo sapiens |
| Alignment Length: | 391 | Identity: | 117/391 - (29%) |
|---|---|---|---|
| Similarity: | 168/391 - (42%) | Gaps: | 49/391 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 98 DCNLALICCSVFGSVENTLFLLKHYNADPNVADSRGRTPLHFACCRANAPIAKVLLDFGADPNRW 162
Fly 163 DARKEVTSLHCAASSKSVECILLLLRRKASIN-IGIEKRSALHYAIDVNAVDCVEILLKYGADPN 226
Fly 227 TPQVYTETPLHTASAAGFAKCVQLLLSHNADVRSQFGEGKVTALHLAAENDYVECARLLLEHRAE 291
Fly 292 VDCRNASHQTPLHLACLSQSIGTVDLLISYGANVNAVYRDGRTALHAAIVKQSRSLDCCNALLKA 356
Fly 357 GADVNKADNYGYTPLHIAALNEFSSCVYTFIEHGAD------------ITARTDGRVSA------ 403
Fly 404 ----LSFIV------RRTPEIIPKLMQKLDS--------------SIKANDQEIGDVDCQIK-LD 443
Fly 444 F 444 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| pyx | NP_612015.1 | Ank_4 | 99..153 | CDD:290365 | 17/53 (32%) |
| ANK repeat | 102..130 | CDD:293786 | 10/27 (37%) | ||
| ANK | 127..252 | CDD:238125 | 41/125 (33%) | ||
| ANK repeat | 132..163 | CDD:293786 | 9/30 (30%) | ||
| Ank_2 | 137..226 | CDD:289560 | 29/89 (33%) | ||
| ANK repeat | 166..196 | CDD:293786 | 13/30 (43%) | ||
| ANK | 198..319 | CDD:238125 | 39/120 (33%) | ||
| ANK repeat | 200..229 | CDD:293786 | 10/28 (36%) | ||
| Ank_2 | 203..296 | CDD:289560 | 31/92 (34%) | ||
| ANK repeat | 231..262 | CDD:293786 | 7/30 (23%) | ||
| ANK | 268..387 | CDD:238125 | 44/118 (37%) | ||
| ANK repeat | 268..296 | CDD:293786 | 11/27 (41%) | ||
| Ank_2 | 270..364 | CDD:289560 | 35/93 (38%) | ||
| ANK repeat | 298..329 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 331..364 | CDD:293786 | 11/32 (34%) | ||
| Ank_5 | 353..404 | CDD:290568 | 19/72 (26%) | ||
| ANK repeat | 366..396 | CDD:293786 | 10/41 (24%) | ||
| Ion_trans | 556..734 | CDD:278921 | |||
| ANK1 | XP_011542792.1 | ANK | 47..163 | CDD:238125 | |
| ANK repeat | 47..75 | CDD:293786 | |||
| ANK | 108..229 | CDD:238125 | |||
| ANK repeat | 109..140 | CDD:293786 | |||
| Ank_2 | 114..204 | CDD:289560 | |||
| ANK repeat | 143..173 | CDD:293786 | |||
| ANK | 170..324 | CDD:238125 | |||
| ANK repeat | 175..206 | CDD:293786 | |||
| ANK repeat | 208..232 | CDD:293786 | |||
| ANK repeat | 241..268 | CDD:293786 | |||
| Ank_2 | 242..333 | CDD:289560 | |||
| ANK | 265..390 | CDD:238125 | |||
| ANK repeat | 271..301 | CDD:293786 | |||
| ANK repeat | 303..334 | CDD:293786 | |||
| Ank_2 | 308..397 | CDD:289560 | |||
| ANK repeat | 336..367 | CDD:293786 | |||
| ANK repeat | 369..400 | CDD:293786 | |||
| Ank | 402..432 | CDD:278452 | |||
| ANK repeat | 405..433 | CDD:293786 | |||
| ANKYR | 406..619 | CDD:223738 | 28/86 (33%) | ||
| ANK | 430..555 | CDD:238125 | 6/21 (29%) | ||
| ANK repeat | 435..466 | CDD:293786 | |||
| ANK repeat | 468..499 | CDD:293786 | |||
| ANK repeat | 501..532 | CDD:293786 | |||
| ANK | 529..654 | CDD:238125 | 41/121 (34%) | ||
| ANK repeat | 534..563 | CDD:293786 | 10/29 (34%) | ||
| ANK repeat | 568..598 | CDD:293786 | 9/30 (30%) | ||
| ANK repeat | 600..631 | CDD:293786 | 13/30 (43%) | ||
| Ank_2 | 605..696 | CDD:289560 | 30/90 (33%) | ||
| ANK repeat | 633..661 | CDD:293786 | 9/27 (33%) | ||
| ANK repeat | 666..697 | CDD:293786 | 7/30 (23%) | ||
| ANK | 666..695 | CDD:197603 | 7/28 (25%) | ||
| ANK | 694..819 | CDD:238125 | 46/127 (36%) | ||
| ANK repeat | 699..730 | CDD:293786 | 13/31 (42%) | ||
| Ank_2 | 704..795 | CDD:289560 | 35/92 (38%) | ||
| ANK repeat | 732..763 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 765..796 | CDD:293786 | 11/32 (34%) | ||
| Ank_5 | 785..839 | CDD:290568 | 16/53 (30%) | ||
| ANK repeat | 798..826 | CDD:293786 | 10/27 (37%) | ||
| ZU5 | 984..1088 | CDD:128514 | |||
| Death_ank1 | 1474..1557 | CDD:260067 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2336 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.940 | |||||