DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and Sowahd

DIOPT Version :9

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_776140.1 Gene:Sowahd / 245381 MGIID:3045274 Length:327 Species:Mus musculus


Alignment Length:330 Identity:73/330 - (22%)
Similarity:117/330 - (35%) Gaps:114/330 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 ADPNVADSR--GRTPLHFACCRANAPIAKV----LLDFGADPNRWDAR----KEVTSLHCAA--- 175
            :||.:.|:.  ||..:......||....::    |...||.   |..|    :|:..|..||   
Mouse    25 SDPQIKDNHCLGRYKVQAVRDSANLSQERIFHSALTVSGAS---WARRRGELRELLGLQGAAPAG 86

  Fly   176 --SSKSVECILLLLRR---KASINIGIEKRSALHYAIDVNAVDC-VEILLK-YGADPNTPQVYTE 233
              |.:.:|..:...||   :.|..:.:|.|   .:|..:.|.:| .|:||: ..|:|:.  :..|
Mouse    87 WLSEEHLEPAVPGSRRSSGQGSSRVCLEPR---EHAWILAAAECRFEVLLEMLEAEPSL--LMRE 146

  Fly   234 TPLHTASAAGFAKCVQLLLSHNADVRSQFGEGKVTALHLAAENDYVECARLLLEH--------RA 290
            .|:     .|:                       :.||..|::...|  .|:|.|        ..
Mouse   147 DPI-----TGY-----------------------SVLHWLAKHGRHE--ELILLHDFARRRGLPF 181

  Fly   291 EVDCRNASHQTPLHLACLSQSIGTVDLLISYGANVNAVYRDGRTALHAAIVKQSRSLDCCNALLK 355
            :|....:...||||||.|..                          |..::|         .|:.
Mouse   182 DVSAPGSGGLTPLHLAALQG--------------------------HDMVIK---------VLVG 211

  Fly   356 A-GADVNKADNYGYTPLHI----AALN--EFSSCVYTFI------EHGADITARTDGRVSALSFI 407
            | |||.::.|:.|..|.|.    |:||  |.|......|      |:..:.::||....:..|..
Mouse   212 ALGADPSRRDHSGNRPCHYLRPDASLNLRELSGAEEWEIERDRKRENANNNSSRTTTTTTTTSRW 276

  Fly   408 VRRTP 412
            ::|||
Mouse   277 LKRTP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_4 99..153 CDD:290365 7/34 (21%)
ANK repeat 102..130 CDD:293786 2/5 (40%)
ANK 127..252 CDD:238125 32/144 (22%)
ANK repeat 132..163 CDD:293786 7/36 (19%)
Ank_2 137..226 CDD:289560 25/106 (24%)
ANK repeat 166..196 CDD:293786 9/37 (24%)
ANK 198..319 CDD:238125 28/130 (22%)
ANK repeat 200..229 CDD:293786 9/30 (30%)
Ank_2 203..296 CDD:289560 19/102 (19%)
ANK repeat 231..262 CDD:293786 3/30 (10%)
ANK 268..387 CDD:238125 31/133 (23%)
ANK repeat 268..296 CDD:293786 8/35 (23%)
Ank_2 270..364 CDD:289560 22/102 (22%)
ANK repeat 298..329 CDD:293786 7/30 (23%)
ANK repeat 331..364 CDD:293786 7/33 (21%)
Ank_5 353..404 CDD:290568 18/63 (29%)
ANK repeat 366..396 CDD:293786 10/41 (24%)
Ion_trans 556..734 CDD:278921
SowahdNP_776140.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 2/5 (40%)
ANK 1 112..141 9/31 (29%)
ANK repeat 119..146 CDD:293786 8/28 (29%)
Ank_2 121..221 CDD:289560 32/166 (19%)
ANK 2 147..162 5/42 (12%)
ANK 150..>230 CDD:238125 26/139 (19%)
ANK repeat 151..187 CDD:293786 9/60 (15%)
ANK 3 186..216 12/64 (19%)
ANK repeat 189..221 CDD:293786 14/66 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 251..311 7/31 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2336
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.