DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and Ankrd52

DIOPT Version :10

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_766378.1 Gene:Ankrd52 / 237615 MGIID:2444029 Length:1076 Species:Mus musculus


Alignment Length:341 Identity:107/341 - (31%)
Similarity:161/341 - (47%) Gaps:66/341 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 GSVENTLFLLKHYNADPNVADSRGRTPLHFACCRANAPIAKVLLDFGADPNRWDARKEVTSLHCA 174
            |.:| |:.||.:..|..||.|.:.|.|||:|....:..:.|:|:..|||.:..| ||....||.|
Mouse   151 GHLE-TVNLLLNKGASLNVCDKKERQPLHWAAFLGHLEVLKLLVARGADLSCKD-RKGYGLLHTA 213

  Fly   175 ASSKSVECILLLLRRKASIN----IGIEKRSALHYAIDVNAVDCVEI-LLKYGADPNTPQVYTET 234
            |:|..:|.:..|||..|.|:    .|   .:|||.|..:.. |.|.| |:..||:.|.|.....|
Mouse   214 AASGQIEVVKHLLRMGAEIDEPNAFG---NTALHIACYLGQ-DAVAIELVNAGANVNQPNDKGFT 274

  Fly   235 PLHTAS-AAGFAKCVQLLLSHNADVRSQFGEGKVTALHLAAENDYVECARLLLEHRAEVDCRNAS 298
            |||.|: :...|.|::||:::.|||..|..||| :.||:||.:.....:::|:::.:|:||.:..
Mouse   275 PLHVAAVSTNGALCLELLVNNGADVNYQSKEGK-SPLHMAAIHGRFTRSQILIQNGSEIDCADKF 338

  Fly   299 HQTPLHLA----------------------------------------CLSQSIGTVDL------ 317
            ..||||:|                                        |..:.:.:..|      
Mouse   339 GNTPLHVAARYGHELLISTLMTNGADTARRGIHDMFPLHLAVLFGFSDCCRKLLSSGQLYSIVSS 403

  Fly   318 -----LISYGANVNAVYRDGRTALHAAIVKQSRSLDCCNALLKAGADVNKADNYGYTPLHIAALN 377
                 ::|.|.::|.....|||.||||  ....:::|.|.||.:|||:.:.|.:|.||||.||.|
Mouse   404 LSNEHVLSAGFDINTPDSLGRTCLHAA--ASGGNVECLNLLLSSGADLRRRDKFGRTPLHYAAAN 466

  Fly   378 EFSSCVYTFIEHGADI 393
            ....|..|.:..||.:
Mouse   467 GSYQCAVTLVTAGAGV 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_2 88..161 CDD:463710 19/50 (38%)
ANK repeat 102..130 CDD:293786 8/19 (42%)
ANK repeat 132..163 CDD:293786 10/30 (33%)
ANKYR 148..435 CDD:440430 93/303 (31%)
ANK repeat 166..196 CDD:293786 12/33 (36%)
ANK repeat 200..229 CDD:293786 11/29 (38%)
ANK repeat 231..262 CDD:293786 12/31 (39%)
ANK repeat 268..296 CDD:293786 8/27 (30%)
ANK repeat 298..329 CDD:293786 10/81 (12%)
ANK repeat 331..364 CDD:293786 14/32 (44%)
ANK repeat 366..396 CDD:293786 12/28 (43%)
Ion_trans <562..734 CDD:459842
Ankrd52NP_766378.1 ANK 1 7..36
Ank_4 10..61 CDD:372654
ANK repeat 11..38 CDD:293786
ANK repeat 40..71 CDD:293786
ANK 2 40..69
ANKYR 56..343 CDD:440430 71/198 (36%)
ANK 3 73..102
ANK repeat 76..104 CDD:293786
ANK 4 106..135
ANK repeat 108..137 CDD:293786
ANK repeat 139..170 CDD:293786 8/19 (42%)
ANK 5 139..168 6/17 (35%)
ANK repeat 172..203 CDD:293786 10/30 (33%)
ANK 6 172..201 10/28 (36%)
ANK repeat 205..236 CDD:293786 12/30 (40%)
ANK 7 205..234 12/28 (43%)
ANK 8 238..267 11/32 (34%)
ANK repeat 238..266 CDD:293786 11/31 (35%)
ANK 9 271..301 12/29 (41%)
ANK repeat 272..303 CDD:293786 12/30 (40%)
ANKYR 289..622 CDD:440430 54/197 (27%)
ANK repeat 305..336 CDD:293786 11/31 (35%)
ANK 10 305..334 9/29 (31%)
ANK 11 338..367 5/28 (18%)
ANK repeat 338..363 CDD:293786 5/24 (21%)
ANK 12 371..400 2/28 (7%)
ANK repeat 375..420 CDD:293786 5/44 (11%)
ANK 13 422..451 14/30 (47%)
ANK repeat 423..453 CDD:293786 14/31 (45%)
ANK repeat 455..486 CDD:293786 12/28 (43%)
ANK 14 455..484 12/28 (43%)
ANK repeat 488..547 CDD:293786
ANK 15 488..545
ANK 16 549..579
ANK 17 584..613
ANK repeat 587..615 CDD:293786
ANK 18 617..646
Ank_4 618..672 CDD:372654
ANK repeat 618..648 CDD:293786
ANK 19 651..680
ANK repeat 653..685 CDD:293786
ANKYR 668..998 CDD:440430
ANK repeat 687..718 CDD:293786
ANK 20 687..716
ANK repeat 720..751 CDD:293786
ANK 21 720..749
ANK repeat 753..784 CDD:293786
ANK 22 753..782
ANK 23 790..819
ANK repeat 822..855 CDD:293786
ANK 24 822..852
ANK repeat 857..888 CDD:293786
ANK 25 857..886
ANK repeat 890..922 CDD:293786
ANK 26 890..920
ANK repeat 924..991 CDD:293786
ANK 27 924..953
ANK repeat 928..958 CDD:293786
ANK 28 960..989
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.