DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and ASB12

DIOPT Version :9

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_569059.3 Gene:ASB12 / 142689 HGNCID:19763 Length:318 Species:Homo sapiens


Alignment Length:188 Identity:57/188 - (30%)
Similarity:85/188 - (45%) Gaps:43/188 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 TSLHCAASSKSVECILLLLRRKASI-NIGIEKRSALHYAIDVNAVDCVEILLKYGADPNTPQVYT 232
            |.|..|||...:.|:.:||...|.: ::.::.::.|..|:....:|||.:||:.||.|. ..:|.
Human    75 TPLRLAASYGHLSCLQVLLAHGADVDSLDVKAQTPLFTAVSHGHLDCVRVLLEAGASPG-GSIYN 138

  Fly   233 E-TPLHTASAAGFAKCVQLLLSHNADVRSQFGEGKVTA---------------LHLAAENDYVEC 281
            . :|:.||:..|....:|.||.|.|       |..|.|               |:|||...:::|
Human   139 NCSPVLTAARDGAVAILQELLDHGA-------EANVKAKLPVWASNIASCSGPLYLAAVYGHLDC 196

  Fly   282 ARLLLEHRAEVDCRNASHQ-----TP---------LHLACLSQSIGTVDLLISYGANV 325
            .||||.|.|:.| .|.:.|     .|         ||..|..:.|   .|||.:|||:
Human   197 FRLLLLHGADPD-YNCTDQGLLARVPRPRTLLEICLHHNCEPEYI---QLLIDFGANI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_4 99..153 CDD:290365
ANK repeat 102..130 CDD:293786
ANK 127..252 CDD:238125 25/84 (30%)
ANK repeat 132..163 CDD:293786
Ank_2 137..226 CDD:289560 18/57 (32%)
ANK repeat 166..196 CDD:293786 9/27 (33%)
ANK 198..319 CDD:238125 43/150 (29%)
ANK repeat 200..229 CDD:293786 10/28 (36%)
Ank_2 203..296 CDD:289560 35/108 (32%)
ANK repeat 231..262 CDD:293786 10/31 (32%)
ANK 268..387 CDD:238125 26/87 (30%)
ANK repeat 268..296 CDD:293786 13/42 (31%)
Ank_2 270..364 CDD:289560 25/70 (36%)
ANK repeat 298..329 CDD:293786 12/42 (29%)
ANK repeat 331..364 CDD:293786
Ank_5 353..404 CDD:290568
ANK repeat 366..396 CDD:293786
Ion_trans 556..734 CDD:278921
ASB12NP_569059.3 Ank_2 8..103 CDD:289560 9/27 (33%)
ANK 75..201 CDD:238125 39/133 (29%)
ANK repeat 75..103 CDD:293786 9/27 (33%)
Ank_2 77..168 CDD:289560 29/98 (30%)
ANK repeat 105..136 CDD:293786 10/31 (32%)
ANK repeat 138..168 CDD:293786 10/36 (28%)
ANK repeat 182..208 CDD:293786 11/25 (44%)
ANK 184..>250 CDD:238125 24/69 (35%)
Ank_2 185..>250 CDD:289560 24/68 (35%)
SOCS_box 277..315 CDD:284857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.