| Sequence 1: | NP_612015.1 | Gene: | pyx / 38037 | FlyBaseID: | FBgn0035113 | Length: | 956 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_840068.1 | Gene: | Asb13 / 142688 | MGIID: | 2145525 | Length: | 278 | Species: | Mus musculus |
| Alignment Length: | 206 | Identity: | 70/206 - (33%) |
|---|---|---|---|
| Similarity: | 115/206 - (55%) | Gaps: | 17/206 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 134 RTPLHFACCRANAPIAKVLLDFGADPNRWDARKEVTSLHCAASSKSVECILLLLRRKASINI-GI 197
Fly 198 EKRSALHYAIDVNAVDCVEILLKYGADPNTPQVYTETPLHTASAAGFAKCVQLLLSHNADVRS-- 260
Fly 261 -QFGEGKVTALHLAAENDYVECARLLLEHRAEVDCRNAS--HQTPLHLACLSQSIGTVDLLISYG 322
Fly 323 ANVNAVYRDGR 333 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| pyx | NP_612015.1 | Ank_4 | 99..153 | CDD:290365 | 6/18 (33%) |
| ANK repeat | 102..130 | CDD:293786 | |||
| ANK | 127..252 | CDD:238125 | 42/118 (36%) | ||
| ANK repeat | 132..163 | CDD:293786 | 11/28 (39%) | ||
| Ank_2 | 137..226 | CDD:289560 | 27/89 (30%) | ||
| ANK repeat | 166..196 | CDD:293786 | 9/30 (30%) | ||
| ANK | 198..319 | CDD:238125 | 41/125 (33%) | ||
| ANK repeat | 200..229 | CDD:293786 | 10/28 (36%) | ||
| Ank_2 | 203..296 | CDD:289560 | 34/95 (36%) | ||
| ANK repeat | 231..262 | CDD:293786 | 12/33 (36%) | ||
| ANK | 268..387 | CDD:238125 | 24/68 (35%) | ||
| ANK repeat | 268..296 | CDD:293786 | 9/27 (33%) | ||
| Ank_2 | 270..364 | CDD:289560 | 23/66 (35%) | ||
| ANK repeat | 298..329 | CDD:293786 | 10/32 (31%) | ||
| ANK repeat | 331..364 | CDD:293786 | 2/3 (67%) | ||
| Ank_5 | 353..404 | CDD:290568 | |||
| ANK repeat | 366..396 | CDD:293786 | |||
| Ion_trans | 556..734 | CDD:278921 | |||
| Asb13 | NP_840068.1 | ANK 1 | 18..47 | 10/26 (38%) | |
| ANK repeat | 20..49 | CDD:293786 | 11/28 (39%) | ||
| ANK | 46..170 | CDD:238125 | 41/129 (32%) | ||
| ANK repeat | 51..82 | CDD:293786 | 9/30 (30%) | ||
| ANK 2 | 51..80 | 9/28 (32%) | |||
| ANK 3 | 84..113 | 10/29 (34%) | |||
| ANK repeat | 84..112 | CDD:293786 | 9/27 (33%) | ||
| ANK 4 | 116..145 | 12/28 (43%) | |||
| ANK repeat | 119..147 | CDD:293786 | 10/27 (37%) | ||
| ANK repeat | 149..179 | CDD:293786 | 12/36 (33%) | ||
| ANK 5 | 149..178 | 11/35 (31%) | |||
| Ank_4 | 152..202 | CDD:316185 | 16/52 (31%) | ||
| ANK repeat | 181..212 | CDD:293786 | 10/32 (31%) | ||
| ANK 6 | 181..210 | 9/28 (32%) | |||
| SOCS_ASB13 | 237..278 | CDD:239699 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||