Sequence 1: | NP_612015.1 | Gene: | pyx / 38037 | FlyBaseID: | FBgn0035113 | Length: | 956 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_543150.1 | Gene: | ASB5 / 140458 | HGNCID: | 17180 | Length: | 329 | Species: | Homo sapiens |
Alignment Length: | 321 | Identity: | 89/321 - (27%) |
---|---|---|---|
Similarity: | 144/321 - (44%) | Gaps: | 29/321 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 LALICCSVFGSVENTLFLLKHYNADPNVADSRGRTPLHFACCRANAPIAKVLLDFGADPNRWDAR 165
Fly 166 KEVTSLHCAASSKSVECILLLLRRKASIN-IGIEKRSALHYAIDVNAVDCVEILLKYGADPNTPQ 229
Fly 230 VYTETPLHTASAAGFAKCVQLLLSHNADVRSQFGEGKVTALHLAAENDYVECARLLLEHRAEVDC 294
Fly 295 RNASHQTPLHLACLSQSIGTVDLLISYGANV-NAVYRDGRTALHAAIVKQSRSLDCCNALLKAGA 358
Fly 359 DVNKADNYGYTPLHIAALNEFSSCVYTFIEHGADITARTD-GRVSALSFIVRRTPEIIPKL 418 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
pyx | NP_612015.1 | Ank_4 | 99..153 | CDD:290365 | 13/51 (25%) |
ANK repeat | 102..130 | CDD:293786 | 8/27 (30%) | ||
ANK | 127..252 | CDD:238125 | 32/125 (26%) | ||
ANK repeat | 132..163 | CDD:293786 | 4/30 (13%) | ||
Ank_2 | 137..226 | CDD:289560 | 22/89 (25%) | ||
ANK repeat | 166..196 | CDD:293786 | 8/30 (27%) | ||
ANK | 198..319 | CDD:238125 | 36/120 (30%) | ||
ANK repeat | 200..229 | CDD:293786 | 10/28 (36%) | ||
Ank_2 | 203..296 | CDD:289560 | 29/92 (32%) | ||
ANK repeat | 231..262 | CDD:293786 | 10/30 (33%) | ||
ANK | 268..387 | CDD:238125 | 37/119 (31%) | ||
ANK repeat | 268..296 | CDD:293786 | 8/27 (30%) | ||
Ank_2 | 270..364 | CDD:289560 | 35/94 (37%) | ||
ANK repeat | 298..329 | CDD:293786 | 11/31 (35%) | ||
ANK repeat | 331..364 | CDD:293786 | 15/32 (47%) | ||
Ank_5 | 353..404 | CDD:290568 | 11/51 (22%) | ||
ANK repeat | 366..396 | CDD:293786 | 4/29 (14%) | ||
Ion_trans | 556..734 | CDD:278921 | |||
ASB5 | NP_543150.1 | ANK 1 | 69..98 | 8/31 (26%) | |
ANK | 71..188 | CDD:238125 | 35/121 (29%) | ||
ANK repeat | 71..100 | CDD:293786 | 9/31 (29%) | ||
ANK repeat | 102..133 | CDD:293786 | 10/30 (33%) | ||
ANK 2 | 102..131 | 9/28 (32%) | |||
ANK 3 | 135..164 | 10/30 (33%) | |||
ANK repeat | 135..160 | CDD:293786 | 9/24 (38%) | ||
ANK 4 | 167..196 | 7/28 (25%) | |||
ANK | 170..283 | CDD:238125 | 37/118 (31%) | ||
ANK repeat | 170..198 | CDD:293786 | 8/27 (30%) | ||
ANK repeat | 200..230 | CDD:293786 | 11/29 (38%) | ||
ANK 5 | 200..229 | 11/28 (39%) | |||
ANK repeat | 232..263 | CDD:293786 | 16/34 (47%) | ||
ANK 6 | 232..261 | 15/32 (47%) | |||
SOCS_ASB5 | 288..329 | CDD:239694 | 7/29 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |