DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pyx and Asb10

DIOPT Version :9

Sequence 1:NP_612015.1 Gene:pyx / 38037 FlyBaseID:FBgn0035113 Length:956 Species:Drosophila melanogaster
Sequence 2:NP_536692.1 Gene:Asb10 / 117590 MGIID:2152836 Length:467 Species:Mus musculus


Alignment Length:376 Identity:112/376 - (29%)
Similarity:158/376 - (42%) Gaps:82/376 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 ADPNRW-DARKEV---------------TSLHCAASSKSVECILLLLRRKASINIGIEKRSALHY 205
            :||.|| |.|..:               |.||.|||....|.:.|||||:|..:.....|:|||.
Mouse    90 SDPERWRDYRFNIRALRLWSLTYEEELTTPLHVAASRGHTEVLELLLRRRAKPDSAPGGRTALHE 154

  Fly   206 AIDVNAVDCVEILLKYGADPNTPQVYTETPLHTASAAGFAKCVQLLLSHNADVRSQFGEGKVTAL 270
            |.......||.:||..||||||.....:.|||.....|..:||:|||...|.|..:..:.:.|.|
Mouse   155 ACSAGHAACVRVLLVAGADPNTLDQDGKRPLHLCRGPGILECVELLLKFGAQVDGRTEDEEETPL 219

  Fly   271 HLAAENDYVECARLLLEHRAEVDCRNASHQTPLHLAC-------------LSQSIGTVDLLISYG 322
            |:||...:||.|.|||...|..|.||:...|||..||             .::......||:|.|
Mouse   220 HIAARLGHVELADLLLRWGACPDVRNSEGWTPLLAACDIRCQSPKDAEATTNRCFQLCRLLLSVG 284

  Fly   323 ANVNAVYRDGRTAL-------HAAIVKQSRSLDCCNALLKAGADVNKADNYGYTPLHIAALNEFS 380
            |:.:|..:|.:..|       |:|:|:         .||..|.:.|..|..|:||||.|.|...:
Mouse   285 ADADAANQDKQRPLHLACRHGHSAVVQ---------LLLSCGVNANAMDYGGHTPLHCALLGPTT 340

  Fly   381 SCVYT-------FIEHGADITARTDGRVSALSFIVRRTPEIIPKLMQKLDSS-----IKANDQEI 433
            :..::       .:.|||                ||..|..:||::.:...|     :..|...:
Mouse   341 AVAHSPEHTVRDLLNHGA----------------VRVWPGALPKVLDRWCMSPRTIEVLMNTYRV 389

  Fly   434 GDVDCQIKLDFRLLVPSSSMDR--GETELLLSLIEVGQKRILMHPLCETFL 482
                .|:..:.:.|||...:.:  |....|.:|:.  |.|.|.| ||...|
Mouse   390 ----VQLPEEAKGLVPPEILQKYHGFYSSLFALVR--QPRSLQH-LCRCAL 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pyxNP_612015.1 Ank_4 99..153 CDD:290365
ANK repeat 102..130 CDD:293786
ANK 127..252 CDD:238125 41/110 (37%)
ANK repeat 132..163 CDD:293786 4/6 (67%)
Ank_2 137..226 CDD:289560 31/84 (37%)
ANK repeat 166..196 CDD:293786 13/44 (30%)
ANK 198..319 CDD:238125 47/133 (35%)
ANK repeat 200..229 CDD:293786 15/28 (54%)
Ank_2 203..296 CDD:289560 37/92 (40%)
ANK repeat 231..262 CDD:293786 11/30 (37%)
ANK 268..387 CDD:238125 43/145 (30%)
ANK repeat 268..296 CDD:293786 13/27 (48%)
Ank_2 270..364 CDD:289560 34/113 (30%)
ANK repeat 298..329 CDD:293786 11/43 (26%)
ANK repeat 331..364 CDD:293786 9/39 (23%)
Ank_5 353..404 CDD:290568 15/57 (26%)
ANK repeat 366..396 CDD:293786 10/36 (28%)
Ion_trans 556..734 CDD:278921
Asb10NP_536692.1 ANK 1 115..144 13/28 (46%)
Ank_4 117..168 CDD:290365 20/50 (40%)
ANK 118..235 CDD:238125 48/116 (41%)
ANK repeat 118..145 CDD:293786 13/26 (50%)
ANK 2 147..176 13/28 (46%)
ANK repeat 148..178 CDD:293786 15/29 (52%)
Ank_2 152..245 CDD:289560 37/92 (40%)
ANK repeat 180..211 CDD:293786 11/30 (37%)
ANK 3 180..209 11/28 (39%)
ANK repeat 213..245 CDD:293786 13/31 (42%)
ANK 4 214..243 12/28 (43%)
ANK 216..334 CDD:238125 41/126 (33%)
Ank_2 219..324 CDD:289560 34/113 (30%)
ANK repeat 247..291 CDD:293786 11/43 (26%)
ANK 5 247..289 10/41 (24%)
ANK repeat 293..324 CDD:293786 9/39 (23%)
ANK 6 293..322 8/37 (22%)
Ank_2 298..>358 CDD:289560 17/68 (25%)
ANK 7 326..361 11/50 (22%)
SOCS 421..460 CDD:239641 7/14 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.