DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7028 and Cdk2

DIOPT Version :9

Sequence 1:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster


Alignment Length:365 Identity:97/365 - (26%)
Similarity:148/365 - (40%) Gaps:104/365 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 LTDNWDDAEGYYRVRIGEVLDNRYLVNGYTGQGVFSNVVRGRDQARGQANVAIKIIR---NNEIM 630
            :.||:..||     :|||              |.:..|.:.|..:.|| :||:|.||   ..|.:
  Fly     4 ILDNFQRAE-----KIGE--------------GTYGIVYKARSNSTGQ-DVALKKIRLEGETEGV 48

  Fly   631 HKTGLRELEILKKLNDADPEDRFHCLRLYRHFFHKQHLCMVFEPLAMNLREVLKKYGKNVGLHIK 695
            ..|.:||:.:||.|...      :.::|:.......:|.|:||.|.|:|::::.|  |......:
  Fly    49 PSTAIREISLLKNLKHP------NVVQLFDVVISGNNLYMIFEYLNMDLKKLMDK--KKDVFTPQ 105

  Fly   696 AVRSYTQQLFLALKLLKKTGILHADIKPDNILVNENNLILKLCDFGSASA--ISDNEITPYLVSR 758
            .::||..|:..|:.......|||.|:||.|:||:....| ||.|||.|.|  :.....|..:|:.
  Fly   106 LIKSYMHQILDAVGFCHTNRILHRDLKPQNLLVDTAGKI-KLADFGLARAFNVPMRAYTHEVVTL 169

  Fly   759 FYRSPEIILGIP-YDYGIDTWSAGCTIYELYTGKILFSGKSN-NQMLKFFM-------------- 807
            :||:|||:||.. |..|:|.||.||...|:...:.||.|.|. :|:.:.|.              
  Fly   170 WYRAPEILLGTKFYSTGVDIWSLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVT 234

  Fly   808 ---DVKGKIPNRIIRKGQFREQHFDQSCNFLYHEIDKLTEREKIVVMPVVKPSRSLQQELIADQN 869
               |.|.|.|                              |.:...||                 
  Fly   235 QLPDFKTKFP------------------------------RWEGTNMP----------------- 252

  Fly   870 LPDDQHRKVTQLKDLLENMFALDPAKRISLNQALVHPFIQ 909
            .|..:|    :..:|:.:|...||..|||...||.|.:.:
  Fly   253 QPITEH----EAHELIMSMLCYDPNLRISAKDALQHAYFR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 90/340 (26%)
S_TKc 599..908 CDD:214567 90/332 (27%)
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 97/364 (27%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 95/358 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442431
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.