DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7028 and Cdk8

DIOPT Version :9

Sequence 1:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_536735.2 Gene:Cdk8 / 39157 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster


Alignment Length:364 Identity:84/364 - (23%)
Similarity:140/364 - (38%) Gaps:93/364 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   580 YRVRIGEVLDNR-YLVNGYTGQGVFSNVVRGRDQARGQANVAIKIIRNNEIMHKTGLRELEILKK 643
            |:.:..|..|.: |.:....|.|:..:..|           .|.::|  |:.|:..:..:.:...
  Fly    36 YKAKWKETSDGKEYALKQIDGTGLSMSACR-----------EIALLR--ELKHQNVITLIRVFLS 87

  Fly   644 LNDAD--------PEDRFHCLRLYRHFFHKQHLCMVFEPLAMNLREVLKKYGKNVGLHIKAVRSY 700
            .||..        ..|.:|.::.:|                     ..|...|.|.:....|:|.
  Fly    88 HNDRKVFLLIDYAEHDLWHIIKFHR---------------------AAKATKKQVVVPRGMVKSL 131

  Fly   701 TQQLFLALKLLKKTGILHADIKPDNILV----NENNLILKLCDFGSASAISD-----NEITPYLV 756
            ..|:...:..|....:||.|:||.||||    ||...: |:.|.|.|...:.     .::.|.:|
  Fly   132 LYQILDGIHYLHSNWVLHRDLKPANILVMGDGNERGRV-KIADMGFARLFNAPLKPLADLDPVVV 195

  Fly   757 SRFYRSPEIILGI-PYDYGIDTWSAGCTIYELYTGKILFSGKSNNQMLKFFMDVKGKIPNRIIRK 820
            :.:||:||::||. .|...||.|:.||...||.|.:.:|..:..        |:|...|      
  Fly   196 TFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQE--------DIKTSNP------ 246

  Fly   821 GQFREQHFDQSCNFLYHEIDKLTEREKIVVMP----VVKPSR-------SLQQELIADQNLPDDQ 874
              :.....|:..|.:....||  :.|.|..||    :.|..:       ||.:.:...:..||.:
  Fly   247 --YHHDQLDRIFNVMGFPQDK--DWEDIKKMPEHHTLTKDFKRSTYSTCSLAKYMERHKIKPDSK 307

  Fly   875 --HRKVTQLKDLLENMFALDPAKRISLNQALVHPFIQEK 911
              |        ||:.:..:||.|||:..||:...:.||:
  Fly   308 AFH--------LLQKLLLMDPNKRITSEQAMQDQYFQEE 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 79/348 (23%)
S_TKc 599..908 CDD:214567 78/339 (23%)
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 82/359 (23%)
S_TKc 22..335 CDD:214567 82/359 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.