DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7028 and Cdk9

DIOPT Version :9

Sequence 1:NP_001286884.1 Gene:CG7028 / 38032 FlyBaseID:FBgn0027587 Length:912 Species:Drosophila melanogaster
Sequence 2:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster


Alignment Length:350 Identity:100/350 - (28%)
Similarity:150/350 - (42%) Gaps:83/350 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   590 NRYLVNGYTGQGVFSNVVRGRDQARGQANVAI-KIIRNNEIMHK-----TGLRELEILKKLNDAD 648
            |:|......|||.|..|.:.|::...:..||: |::.:||   |     |.|||:.||:.|...:
  Fly    48 NKYEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNE---KEGFPITALREIRILQLLKHEN 109

  Fly   649 PEDRFHCLRL-------YRHFFHKQHLCMVFEPLAMNLREVLKKYGKNVGLHIKAVRSYTQQLFL 706
            ..:.....|.       ||..|:     :||:....:|..:|.  ..||...:..::...|||..
  Fly   110 VVNLIEICRTKATATNGYRSTFY-----LVFDFCEHDLAGLLS--NMNVKFSLGEIKKVMQQLLN 167

  Fly   707 ALKLLKKTGILHADIKPDNILVNENNLILKLCDFGSASAI------SDNEITPYLVSRFYRSPEI 765
            .|..:....|||.|:|..|:|:.::. ||||.|||.|.|.      |.|..|..:|:.:||.||:
  Fly   168 GLYYIHSNKILHRDMKAANVLITKHG-ILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPEL 231

  Fly   766 ILGIPYDYG--IDTWSAGCTIYELYTGKILFSGKSNNQMLKFFMDVKGKI-PNRIIRKGQFREQH 827
            :|| ..:||  :|.|.|||.:.|::|...:..|.:..|.|.|...:.|.. |:            
  Fly   232 LLG-DRNYGPPVDMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPD------------ 283

  Fly   828 FDQSCNFLYHEIDKLTEREKIVVMPVVKPSRSLQQELIADQNLPDDQHRKVTQ-----LK----- 882
                                  |.|.|:     :.||.....||.:|.|:|.:     :|     
  Fly   284 ----------------------VWPGVE-----ELELYKSIELPKNQKRRVKERLRPYVKDQTGC 321

  Fly   883 DLLENMFALDPAKRISLNQALVHPF 907
            |||:.:..|||.|||..:.||.|.|
  Fly   322 DLLDKLLTLDPKKRIDADTALNHDF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7028NP_001286884.1 STKc_PRP4 591..908 CDD:271037 98/348 (28%)
S_TKc 599..908 CDD:214567 97/340 (29%)
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 99/349 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442429
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.